KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260178Help
Entry
112260178         CDS       T05605                                 

Definition
(RefSeq) procollagen galactosyltransferase 2-like
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00310  Lysine degradation
otw00514  Other types of O-glycan biosynthesis
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    112260178
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    112260178
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:otw01003]
    112260178
Enzymes [BR:otw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     112260178
Glycosyltransferases [BR:otw01003]
 O-Glycan biosynthesis
  O-linked Gal type
   112260178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 Glycos_transf_2 PRTase_3
Motif
Other DBs
NCBI-GeneID: 112260178
NCBI-ProteinID: XP_024290849
LinkDB All DBs
Position
10
AA seq 591 aa AA seqDB search
MFLWVLVLVAFVSRTECYFSEEKYQEESKIQPPTIIIAIIARNAAHSLPYYLGALERQNY
PKNRISVWAATDHNADNTTAVLKEWLTVMQKFYHYVEWRPMEHPTSYPGEMGPKYWSNGR
YEYLMKLKQAALNFAKQRWADYILYVDTDNILTNPETLNLLIAENKSVVAPMLDSQGAYS
NYWCGITPQGYYRRTAEYFPTRHRHRLGCYPVPMVHSTFLLDMRKTGMKKLAFHPPHQDY
SWPFDDIIVFAFSCRVSEVQMYLCNKVRYGYLNVPAKPHHTIEDDSINFSHLILDAMIDG
PSMAPSKYVSLFPKRRDLMGFDEVYLINLRRRQDRRDRMLYSLNELEIDVKVVDAIDGGA
LNSSDIKILGVDILPGYYDPFSRRTLTKGEVGCFLSHYYIWKEMVDQQMDKALIFEDDVR
FQANFKRRVLRLMEEVEMVELDWDIIYLGRKQVTPGDEEEVVENVRNLVVADYSYWTLSY
AISLQGAQKLLNAEPLSKMLPVDEFLPIMYDKHINEDYKSHFANRNLQAFSTRPLLVQPA
HYAGDPEWVSDTETSTLWDDDNVRTDWRGSHKTLKGAPQSDMLQATYKDEL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttgggttttagttttagtggccttcgtttccagaacagaatgttatttttcg
gaggaaaaatatcaagaagaatcgaaaattcagccgccaacgattattattgcgatcatt
gctcggaacgcggcgcactctttgccatactacctcggggcgttggagaggcagaactat
cccaaaaaccgcatctctgtatgggcagcaacagatcacaacgctgacaacactacagct
gttctgaaagaatggctgaccgtcatgcagaagttctatcactatgtggagtggaggccc
atggagcatcctacgtcctacccaggagagatggggcctaaatactggagcaacggcaga
tatgaatacctgatgaaactcaaacaggctgctctcaacttcgccaagcaacgctgggct
gactacatactgtatgtagacacagacaacatcttgaccaacccagagaccctcaacctc
ctgatagcagagaacaagtctgtggtcgcccccatgttggactcccagggagcttactct
aactactggtgcggcatcactccacagggttactaccggcgtacggctgagtatttcccc
accagacaccgccatcggctgggctgctacccggtgcccatggtccactctaccttcctg
ctggacatgaggaagacgggaatgaagaagctggccttccaccctcctcaccaggactac
tcctggcccttcgatgacatcatcgtcttcgccttctcctgtcgcgtctcagaggtgcag
atgtacctgtgcaacaaggtgaggtatggatacctgaacgtcccagccaagcctcaccac
accatagaggacgacagcatcaacttcagccacctcatcctggacgccatgattgacgga
ccctccatggccccctccaaatatgtcagcctcttccccaaacggagagacctcatgggc
tttgatgaggtgtacctgatcaacctgcgtcggcgtcaggaccgtagggacaggatgctg
tactctctcaacgagctggagatcgacgtcaaagtggtggacgccatagacggaggagcg
ctgaacagcagtgatataaagatccttggagtggacatactacctggttactatgacccg
ttctctcgtcgtaccctgaccaaaggagaggtgggatgcttcctcagccactattacatc
tggaaggagatggtagaccagcagatggataaggctctgatcttcgaggacgacgtgcgt
ttccaggccaacttcaagcggcgcgtgctccgtctgatggaggaggtggagatggtggaa
ctggactgggacatcatttacctgggccgtaagcaggtgacgccgggtgacgaggaggag
gtggtggagaacgtgaggaacctggtggtagcagactattcctactggaccctgtcctac
gccatctctctccagggggcccagaagctgctcaacgccgaacccctctccaagatgctg
cccgtcgacgagttcctgcccatcatgtacgacaaacacatcaatgaggactacaagtct
cacttcgcgaaccgtaacctgcaggcgttctctacgcgcccccttctggtgcaaccagcc
cactacgctggggaccccgagtgggtgagcgacacggagacctccacgctgtgggacgac
gacaacgtgcgaacagactggaggggttcccacaaaaccctgaagggggcacctcaatcc
gacatgctgcaggcaacgtataaggatgagctctag

DBGET integrated database retrieval system