KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263705Help
Entry
112263705         CDS       T05605                                 

Definition
(RefSeq) MARVEL domain-containing protein 3-like
  KO
K21099  MARVEL domain-containing protein 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112263705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:otw02000]
    112263705
Transporters [BR:otw02000]
 Other transporters
  Pores ion channels [TC:1]
   112263705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL PNISR MIG-14_Wnt-bd DUF4328
Motif
Other DBs
NCBI-GeneID: 112263705
NCBI-ProteinID: XP_024295996
LinkDB All DBs
Position
12
AA seq 335 aa AA seqDB search
MPERSRYQERDEYDKSRERDRTHDRGSSSHEERDRERKRERDRQKRDQMDERYRDEKDSG
ADRRVREKDYSGRQRDTTPHSHKDAPPDHRGSSQQGQQRAYTEASTTPSVGEYYEPQHRQ
ALYNLRYALTARGLCQIMEVFVNLLIVICSGVSYSNSGGYRDLASLGGLYQYYYGGAQAF
TGADADRVKELDKLFHQLKLPPYIFSMACGGALMVYACIILAFGVLRVPYRWPPVLLGEA
LVNLLIGLGYIPALAFYFIKLQETYDNPICTEREALYKSKGHQGFACALNGADIAGGLFG
VLGVIVFIFGMVLAIRAFRAVREMKRLRAMEDGNL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgccagagagaagcagataccaggagagggatgagtatgacaagagcagggagagggac
cgcactcacgaccgaggaagctcctcacatgaagagagagaccgggaaaggaaaagagag
agagaccggcagaagagagaccaaatggacgagagatacagggatgagaaggactctgga
gctgacaggagggtcagggagaaggactactctggcagacagcgggatacgacacctcac
tctcacaaggacgcaccacctgaccacagaggcagtagtcaacaaggacaacagagagcg
tatacagaagcctccacaactccctctgtgggggaatactatgagccacaacacagacag
gctctgtacaacctcagatatgccttaacagccagaggtctatgccagataatggaggtc
tttgtaaacctgctgatagtcatctgctcaggagtgtcctacagtaactccgggggttac
cgggacctggccagcctcgggggtctctaccagtactactatggaggagcacaggctttc
actggagccgacgcagacagggtcaaggagctggacaaactgttccaccagctcaagcta
cctccatacatcttcagcatggcctgtggaggggctctgatggtttatgcctgcatcatt
ctggctttcggggttttgagagtcccttaccgctggccccctgtgctgctgggtgaggcc
ctggtgaacctcctgatcggcctgggctacatccctgcactggccttctacttcatcaag
ctgcaggaaacctacgacaaccccatctgtacagaaagggaagcgctctacaagagcaaa
gggcatcagggctttgcatgtgcactcaatggagcagacatcgctggaggcctcttcggg
gtgcttggagtcattgttttcatcttcggaatggtcttggccatccgtgctttcagggca
gtgagggagatgaagagactgagagcgatggaagatggtaacttataa

DBGET integrated database retrieval system