KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264772
Entry
112264772         CDS       T05605                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04141  Protein processing in endoplasmic reticulum
otw04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112264772
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112264772
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112264772
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112264772
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU DUF724 Yuri_gagarin GAS CENP-H DUF4140 FapA
Other DBs
NCBI-GeneID: 112264772
NCBI-ProteinID: XP_024297363
LinkDB
Position
13
AA seq 705 aa
MTTDLLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEDGEYTRGPKYETSFDNDLVLTL
DPDNPTSPWRHLDDNLLTGDIPVLKDEMTITQPLPVDMLFRVKAEPPSPASSLASDCSLT
SLPDSQIQVKGENPPTPPYMFGDVLAPPLGTCEVTVASAQLARPQSKVPPQQHQTSTHNG
MDTQATVHPTAATIKASTILSSKPLIQPRPVCVAALSVPQAPSPAKALILHSLPSRDQSR
PVVLSQSVCLGSAPAIVKMEPASPTMPHCHSPTAPFPGKPIVPASSLPGSNCNGMDVSVC
QSHVSQSMKVMKRQQRMIKNRESACQSRKKKKEYLQNLEGQLREVQQENEHLRRENQALR
ERLAGKEGSESGNNKRAVCVMAVLLFMTFSFGPVSITDRKLETGLQEEVVPHTGRHLLEF
ETAREHSRVEERIDPEEEGGEDGWKGGEVERESTDSYQFRNLSDVFSDVKDLVLQDIDRY
FTSNDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKIVKKAKIAQKAQLRKTNISR
YLPIQTHRSIDSQIQVFPAGPEISYSDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTT
RPKMSLVMPAMSVNESLYNKSQGYEMMMQVDCEVMDTRIIPIKASAVPPSLRDPPPAPPA
HHHHSNHTSLRGRHHPHTGGAASPRQPLPVSRQEAEYYIGQGGGV
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgactacggatttactatctgatttggatagtcgtttcttcgctgataaccttctgaca
agcgaggattgggatgcctgtctgtaccagtgtgagagcatggaggagggagaggacgga
gagtacacgagaggaccaaaatatgaaacatcgtttgacaacgatctcgtgctgaccctt
gatcccgacaatcccacgtcgccatggagacacctggacgacaaccttctcacaggggac
attcccgtactgaaagatgaaatgacgataacgcagcctttgccagtggacatgttgttc
cgggtgaaggcggagcctccctcccctgcctcctcactggcctccgactgctccctgacc
tcactcccagactcacagatccaagtgaaaggagagaacccgcccacgcctccttatatg
tttggagatgtgctggcaccaccacttggcacatgtgaagtcacggtggcctctgcacaa
ctggcccgaccacagtccaaagtgccgcctcagcaacaccaaacatcaacccacaatggc
atggacacacaggccacagtccaccccactgcggccacgatcaaagccagtaccatcctg
agcagtaagcctctcatccaacccaggcctgtgtgtgtagcggctctctccgtcccccag
gctcccagtccagccaaggccctcatactgcacagcctgcctagcagggaccagagcagg
cctgtggtgctttcccagtcagtctgtctggggtccgcgccagccatcgtcaaaatggag
cccgcctcccccaccatgcctcactgccatagccccacggccccattccccggcaaaccc
atagtcccggcgtcctctctgccagggagcaactgcaacggcatggatgtgagtgtctgt
cagtcgcatgtcagtcagtcaatgaaggtgatgaagaggcagcagcggatgatcaagaac
cgggagtcggcatgccagtcacgcaagaagaagaaggagtacctgcagaacctggagggc
cagctgagggaggtgcagcaggagaacgagcacctccgcagggagaaccaggccctgagg
gagaggcttgctgggaaagagggcagtgaatctggtaacaacaagagggccgtctgcgtc
atggcagtgctactgttcatgaccttcagtttcggccctgtcagtatcacagacaggaag
ctggagacggggttacaggaagaggtggtccctcacacaggaagacatctcctggagttt
gagacggctcgggaacatagcagagtggaggaaaggatagatcctgaggaggagggagga
gaggatgggtggaagggaggagaggtggagagggaatccaccgattcataccagtttagg
aacctgagtgacgtgttcagcgacgtgaaggacctggtcctgcaggacatcgaccgctat
ttcacctccaatgactgcaggcagttcaaccgctccgagtccctcaggctggcagatgag
ctgagaggatgggtccacaggcaccagatcgacaggaagaagtctggagggaagccgaag
atagtgaaaaaagctaaaatagcgcagaaagcgcagcttaggaagaccaacatctccaga
tatcttcccatccagacccatcgttccattgacagtcagatacaagtgttccctgccggt
ccagagatcagctacagtgacttcatggacgccatcgaccggcgtgaggacaccttctac
gtggtctccttcagacgggatcacctgctgttgccagccatcagccacaacaaaaccaca
cggcccaaaatgtccctggtgatgccggctatgtccgtcaacgagagtttatataacaaa
tcccagggctatgagatgatgatgcaggtggattgtgaggtcatggacacccggatcatc
cccatcaaagcctccgctgttcccccgtcgctccgcgacccccctcccgctccccccgcc
caccatcaccacagcaaccacacctccctccgaggccgccaccatccccacaccggcgga
gcggcgtctccacggcaacccttacctgtcagcagacaggaggccgagtattacatcggc
caggggggcggggtttga

DBGET integrated database retrieval system