KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265290
Entry
112265290         CDS       T05605                                 

Definition
(RefSeq) alpha-actinin-4-like isoform X1
  KO
K05699  actinin alpha 1/4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265290
   04520 Adherens junction
    112265290
   04530 Tight junction
    112265290
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112265290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112265290
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112265290
   04147 Exosome [BR:otw04147]
    112265290
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    112265290
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112265290
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112265290
  Exosomal proteins of colorectal cancer cells
   112265290
  Exosomal proteins of bladder cancer cells
   112265290
SSDB
Motif
Pfam: Spectrin CH CAMSAP_CH EF-hand_1 EF-hand_6
Other DBs
NCBI-GeneID: 112265290
NCBI-ProteinID: XP_024298210
LinkDB
Position
13
AA seq 807 aa
MVDYHASNSQASSGGPAIYMDPREQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDYIAGKGVKLVSI
GAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFH
ISWKDGLAFNALIHRHRPELIDYDKLRKDDPLTNLNNAFEVAEKYLDIPKMMDAEDIVGT
LRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLDWI
RRTIPWLENRAPEKTMAEMQQKLEDFRGYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNR
PAFMPSEGRMVSDINGSWHNLEGAEKGYEEWMLNEIRRLERLDHLAEKFRQKATIHESWT
DGKEAMLTQKDYETASLSEVKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSP
SVNARCQKICEQWDALGSLTQSRRESLERTEKQLESIDELYLEYAKRAAPFNNWMEGAME
DLQDMFIVHNIEEIQGLITAHEQFKSTLPEANKEREAIQAIQAEVQKIAQYNGIKLSGGN
PYTTITPKTIDNKWDKVEQLVPQRDQALQEELAKQQSNDHLRRKFATQANIVGPWIQTKM
EEIGRISIEMNGTLEDQLVNLREYEQSIIEYKPNIDQLEGDHQLIQEALIFDNKYTAYTM
EHLRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLHEYRTSFNHFDKDHSGGLMAEE
FKACLISLGYDVENNKTGDGSLPASWA
NT seq 2424 nt   +upstreamnt  +downstreamnt
atggtagattatcacgcttctaatagtcaagcatcgtctggaggtccagccatttacatg
gacccaagagaacaagaaaatgactgggaccgggacctgctgctggacccggcctgggag
aaacagcagagaaagacgttcacggcctggtgcaactcccacctgaggaaagcaggcacg
cagatcgagaacatcgaggaggacttcagggatggcctcaaactcatgctcctgctggag
gtcatctcaggggaacggttacctaagcccgagagaggcaagatgagggtccacaagatc
aacaacgttaacaaagctctggactacatcgccggcaaaggagttaagctggtgtccatt
ggcgcggaggaaattgtggatggcaacgccaagatgaccctgggcatgatctggacaata
atcctccgtttcgccatccaggacatctctgtggaagagacctctgccaaggagggcctg
ctcttgtggtgccagaggaagaccgcgccctacaaaaacgtcaacgtgcagaacttccac
atcagctggaaggatggccttgccttcaacgctctgatccacagacacaggccagagctc
attgactacgacaagctaaggaaggatgaccccttgaccaacctgaacaatgcctttgag
gtggctgagaagtacctggacatccccaagatgatggacgctgaagacatcgtgggcacg
ctgaggcccgacgagaaggccatcatgacctatgtctcctgcttctatcacgccttctct
ggcgcccagaaggctgagactgcagccaataggatctgcaaggtgctggctgtcaaccag
gagaatgagcacctcatggaggactacgagaagctggccagtgacctgttggactggatc
cgccggaccatcccgtggctggagaaccgggctccagagaagaccatggccgagatgcag
cagaagctggaggacttccggggctaccgccgcgtccacaagccccccaaggtgcaggag
aagtgtcagctggagatcaacttcaacaccctgcagaccaagctgaggctgagcaacagg
ccagccttcatgccctctgaaggacgcatggtgtcggacatcaacgggtcgtggcacaac
ctggagggggcggagaagggctacgaggagtggatgctcaacgagatccgtcgcctggag
agactggaccacctggctgagaagttccgtcagaaagccaccatccacgagtcctggacc
gatggtaaggaggccatgctgacccagaaggactatgagacagccagcctgtcggaggtc
aaggctctgctgaggaaacacgaggcgtttgagtctgacctggccgcccaccaagaccgc
gtggagcagatcgctgccatcgcacaggaactcaatgagctggactactacgactcccct
agtgtgaacgcccgctgtcagaagatctgtgagcagtgggatgctctggggtctctcacc
cagagccgcagggagtctctggagaggacagagaagcagctggagtccattgacgagctg
tacctggagtacgccaagagggcggcacccttcaacaactggatggagggggccatggag
gacctgcaggacatgttcatcgttcacaacatcgaagagatccagggcctaatcacagcc
catgagcagtttaagtccaccctcccagaggccaacaaggagcgggaggccatccaggcc
attcaggcggaggtgcagaagattgcccagtacaacggcatcaagctgagcgggggcaac
ccctacaccaccatcacacccaagactatcgacaacaagtgggacaaggtggaacagctg
gttccccagcgtgaccaggctctgcaggaggagctggccaagcagcagtccaatgaccac
ctgcgccgcaagtttgccacccaggccaacatcgtcgggccctggatacagaccaaaatg
gaggagattgggcggatatccattgagatgaatggaactctggaggaccagctggtgaac
ctgagagagtatgagcagagcatcatagagtacaagcccaacatcgaccagctggaggga
gaccatcagctcatccaggaggctctcatcttcgacaacaaatacaccgcctacaccatg
gagcatctgcgggtgggctgggagcagctcctcaccaccatcgcccgcaccatcaacgag
atcgagaaccagatcctgacacgtgacgccaagggcatcagccaggagcagctgcatgag
taccgcacttccttcaaccactttgacaaggaccacagcgggggcctgatggctgaggag
ttcaaggcgtgtctgatcagcctgggctacgatgtggagaataacaaaacgggcgatggg
agtttgcccgcatcatgggcatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266874
Entry
112266874         CDS       T05605                                 

Definition
(RefSeq) alpha-actinin-4 isoform X1
  KO
K05699  actinin alpha 1/4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112266874
   04520 Adherens junction
    112266874
   04530 Tight junction
    112266874
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112266874
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112266874
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112266874
   04147 Exosome [BR:otw04147]
    112266874
Membrane trafficking [BR:otw04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    112266874
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112266874
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112266874
  Exosomal proteins of colorectal cancer cells
   112266874
  Exosomal proteins of bladder cancer cells
   112266874
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_8 EF-hand_6 CAMSAP_CH EF-hand_7 DUF349
Other DBs
NCBI-GeneID: 112266874
NCBI-ProteinID: XP_024300533
LinkDB
Position
14
AA seq 924 aa
MVDYHASNNQASSGGPAVYMDPREQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDYIASKGVKLVSI
GAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFH
ISWKDGLAFNALIHRHRPELIDYDKLRKDDPLTNLNNAFEVAEKYLDIPKMMDAEDIVGT
LRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWI
RRTIPWLENRAPEKTMAEMQQKLEDFRGYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNR
PAFMPSEGRMVSDINGSWHNLEGAEKGYEEWMLNEIRRLERLDHLAEKFRQKATIHESWT
DGKEAMLTQKDYETASLSEVKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSP
SVNARCQKICEQWDALGSLTQSRRESLERTEKQLESIDELYLEYAKRAAPFNNWMEGAME
DLQDMFIVHNIEEIQGLITAHEQFKSTLPEANKEREAIQAIQAEVQKIAQYNGIKLSGGN
PYTTITPKSIDDKWHKVEQLVPQRDRALQEELAKQQSNDHLRRKFATQANIVGPWIQTKM
EEIGRISIEMNGTLEDQLVNLREYEQSIIEYKPNIDQLEGDHQLIQEALIFDNKYTAYTM
EHLRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLHEYRTSFNHFDKDHSGALMAEE
FKACLISLGYDVENNKAKRTGQMDMDNYRALLVATGNSLGDAEFARIMGIVDPNNSGAVT
FQAFIDFMSRETTDTDTADQVIASFKILAADKNFITAEELRRELPPDQAEYCIARMAPYS
GPDAKPGALDYMSFSTALYGESDL
NT seq 2775 nt   +upstreamnt  +downstreamnt
atggtagattatcacgcttctaataatcaagcatcgtctggaggaccagccgtttacatg
gacccaagagaacaagaaaatgattgggaccgggacctgctgctggacccggcctgggag
aaacagcaaagaaagacgttcacggcctggtgcaactcccacctgaggaaagcaggcacg
cagatcgagaacatcgaggaggacttcagggatggcctcaaactcatgctcctgctggag
gtcatctcaggggaacggttacctaagcccgagagaggcaagatgagggtccacaagatc
aacaacgttaacaaagcgctggactacatcgccagcaagggggtcaagctggtgtccatt
ggcgcagaggaaattgtggatggcaacgccaagatgaccctgggcatgatctggacgatc
atcctccgcttcgccatccaggacatctccgtggaagagacctctgccaaggagggcctg
ctcctgtggtgccagaggaagactgcgccctacaaaaacgtcaacgtgcagaacttccac
atcagctggaaggatggccttgccttcaacgctctgatccacagacacaggccagagctc
attgactacgacaagctaaggaaggatgaccccttgaccaacctgaacaatgcctttgag
gtggctgagaagtacctggacatccccaagatgatggatgctgaagacatcgtgggcacg
ctgaggcctgacgagaaggccatcatgacctatgtctcctgcttctatcatgccttctct
ggtgcccagaaggctgagactgcagccaataggatctgcaaggtgctggctgtcaaccag
gagaatgagcacctgatggaggactacgagaagctggccagtgacctgttggagtggatc
cgccggaccatcccgtggctggagaaccgggctccagagaagaccatggccgagatgcag
cagaagctggaggacttccggggctaccgccgcgtccacaagccccccaaggtgcaggag
aagtgtcagctggagatcaacttcaacaccctgcagaccaagctgaggctgagcaacagg
cccgccttcatgccctccgagggacgcatggtgtcggatatcaacgggtcgtggcacaac
ctggagggggcggagaagggctatgaggagtggatgctcaatgagatccgtcgcctggag
agactggaccacctggctgagaagttccgtcagaaagccaccatccacgagtcctggacc
gatggtaaggaggccatgctgacccagaaggactatgagacagccagcctgtcggaggtc
aaggctctgctgaggaaacacgaggcgtttgagtctgacctggccgcccaccaagaccgc
gtggagcagatcgctgccatcgcacaggaactcaatgagctggactactacgactcccct
agtgtgaacgcccgctgtcagaagatctgtgagcagtgggatgctctggggtctctcacc
cagagccgcagggagtctctggagaggacagagaagcagctggagtccattgacgagctg
tacctggagtacgccaagagggcggcacccttcaacaactggatggagggggccatggag
gacctgcaggacatgttcatcgttcacaacatcgaagagatccagggcctaatcacagcc
catgagcagttcaagtctaccctcccagaggccaacaaggagcgggaggccatccaggcc
attcaggccgaggtgcagaagattgcccagtacaatggcatcaagctgagcgggggcaac
ccctacaccaccatcacacccaagagtatcgacgacaagtggcacaaggtggaacagctg
gtgccccagcgtgaccgggccctgcaggaggagctggccaagcagcagtctaacgaccac
ctgcgccgcaagtttgccacccaggccaacatcgtcgggccctggatacagaccaaaatg
gaggagattgggcggatatccattgagatgaatggaactctggaggaccagctggtgaac
ctgagagagtatgagcagagcatcatagagtacaagcccaacatcgaccagctggaggga
gaccatcagctcatccaggaggctctcatcttcgacaacaagtacaccgcctacaccatg
gagcacctgcgggtgggctgggagcagctcctcaccaccatcgcccgcaccatcaacgag
atcgagaaccagatcctgacccgtgacgccaagggcatcagccaggagcagctgcatgag
taccgcacttccttcaaccactttgacaaggaccacagcggggccctgatggctgaggag
ttcaaggcgtgcctgatcagcctgggttacgatgtggagaataacaaagcgaagcgcaca
gggcagatggacatggacaattaccgcgctctgctcgttgcgactggaaacagcctgggt
gatgccgagtttgcccgcatcatgggcatagtggaccccaacaacagtggagctgtcacc
ttccaggccttcatagacttcatgtcccgggagaccacggacaccgacacagccgaccag
gtcatcgcctccttcaagatcttggctgcagacaagaacttcatcacggctgaggagctg
aggcgtgagctgcctccagaccaggcagagtactgcatcgcccgcatggcgccctactcg
ggccctgacgcgaagcccggagctctcgactacatgtccttctctaccgccctctacggg
gagagtgacctctag

DBGET integrated database retrieval system