KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265485Help
Entry
112265485         CDS       T05605                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17-like
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00512  Mucin type O-glycan biosynthesis
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    112265485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:otw01003]
    112265485
Enzymes [BR:otw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     112265485
Glycosyltransferases [BR:otw01003]
 O-Glycan biosynthesis
  Mucin-type
   112265485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 112265485
NCBI-ProteinID: XP_024298598
LinkDB All DBs
Position
13
AA seq 598 aa AA seqDB search
MAFVFRRWRVLLVLNVIAVAGFMTLWTKCTHNRVTKTIGQDDVKRQSRSNGTAQGLSISH
EGLLKRLGSLEDVVYRQLNGLSKSLGLIEGFGGRGKGGLPATLATKEEDDAKVLREKYGY
NAYLSQKISLDRSIPDYRPSKCKKASFPRDLPNISLIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDYSDDEQLKGPLEDYVNKRYPGLVKMVRNQKREGLIRARIEGWKAASGE
VTGFFDAHVEFTPSWAEPVLTRIKEDHKRIILPSIDNIKHETFELERYENSGHGYNWELW
CMYINPPKQWWDDGDTSAPIRTPAMIGCSFVVNRDYFGHLGLLDSGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIARMKKPYHSNIASSTRRNALRVAEVWMDQFKSHVYLAWNIP
MENHGIDYGDISQRVALRKSLQCKNFEWYLDNVYPEMRRYNNTVFYGEIRSSKATHLCMD
QGEKVNHTATLHPCHGMGPQLGRYTKEGQFFLGALGSTGEETRCLMDDQVSNFPQLLNCD
KVSNTRLTTWHFSQNDSIINRATGRCLEVIQANAYFGHSLVLQTCSGQKWNIKNTMKQ
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtgttcagacgatggagagtgttattggtgctgaacgtgattgcggttgcg
gggttcatgacgctttggaccaagtgcacccacaaccgagtgacaaaaaccatcggtcag
gacgatgtgaaaagacaatcacgctctaacggcacggctcaaggtttgagcatcagtcat
gaaggattactaaagagactcgggtcattggaggacgtggtctacagacagcttaatggt
ctgtccaagtccctggggctgattgagggtttcggggggcgaggtaaagggggcctcccc
gccaccttagccacaaaagaggaggatgacgcaaaagtactgagggaaaagtatggatac
aacgcttacctcagccaaaagatatcactggatcggtccataccagactaccggcccagc
aagtgtaaaaaggccagctttcccagggatcttccaaacatctcccttatctttatcttt
gtcaatgaggcgttgtcagtaatcctccgctcggtccactcagctgtcaatcacacaccg
gctcacctcctcaaagagatcatcttggtggacgactacagcgatgatgaacaactgaaa
gggccattggaggattatgtaaacaaacgttacccaggcctggtgaaaatggtgaggaac
cagaagcgtgagggactgatccgtgcccgcatcgagggctggaaggcagccagtggcgag
gtgactggattcttcgatgcccacgttgagttcacaccctcctgggctgagccggttctg
accagaatcaaagaggaccacaagaggatcatcctgccctccatcgataacatcaagcat
gagacgtttgagctggagcgctacgagaactctggccatggctacaattgggagctgtgg
tgcatgtacatcaacccccccaaacagtggtgggatgatggggacacctccgcacccatt
agaactcctgcaatgattggttgctcctttgtggtgaaccgggactactttgggcacctg
gggctgctggactctggcatggacgtctacggaggagagaacatcgaactggggatcaag
gtgtggctgtgtgggggcagtatggaggtgctgccctgctccagggtggctcacattgcc
aggatgaagaagccctaccacagcaacatagcctccagcacgcggcgtaatgccctgcgc
gtggccgaggtctggatggaccagtttaagtcacatgtctacctggcttggaacatccca
atggagaaccatgggatagactatggagacatctctcagagggtagcattgaggaaatct
ctgcaatgtaagaactttgaatggtacctggacaacgtctatccagagatgaggaggtac
aacaacaccgtcttttacggggagattcgtagtagcaaagcgacccatctgtgtatggac
cagggagagaaggtgaaccacacagccaccctgcacccctgtcacggaatgggaccccag
ttgggtcggtacaccaaggagggacagtttttccttggtgctctgggcagtacaggggag
gaaacacgctgtctgatggacgatcaggtctccaattttcctcagctcctcaactgtgac
aaagtctccaacaccaggctgaccacatggcacttctctcagaacgactcaatcatcaac
agagccacgggtcgctgtctggaggtgatacaggcgaacgcttacttcggacactcgctg
gtgcttcagacctgctctggacagaagtggaacatcaaaaacacaatgaagcagtag

DBGET integrated database retrieval system