KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265713
Entry
112265713         CDS       T05605                                 

Definition
(RefSeq) integrin-linked protein kinase
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03320  PPAR signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112265713
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    112265713
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112265713
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112265713
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112265713
Protein kinases [BR:otw01001]
 Serine/threonine kinases: TKL group
  MLK family
   112265713
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112265713
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ank_5 Ank Ank_2 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 112265713
NCBI-ProteinID: XP_024299042
LinkDB
Position
13
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSSVVDMLIMRGARI
NVMNRGDDTPLHLASSHGHRDIVGKLIQCKADTNTANEHGNTPLHYACFWGQELVAEDLV
TNGAQVNICNKYGETPLDKAKPHLREALQEKAEKLGQSLTKVPFKDTFWKGTTRTRPRNG
TLNKAAGIDFKQLSLLAKINENQSGELWQGRWQGNEVVVKVLKVRDWSTRKSRDFNEEYP
KLRIFSHPNVLPMLGACQSPPAPHPIIITHWMPYGSLYNVLHEGTNFVVDQTQAVKFALD
IACGMAFLHTLEPMISRHSLNSKSVMIDEDMTARISMSDVKFSFQCPGRMYSPAWVAPEA
LQKKPEEINRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
ICKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggatgatatttttacccagtgccgggaaggcaacgcagtagctgttcgcctatggttg
gacaacacagagaatgacctcaatcagggtgatgaccatggcttcagtcctctccactgg
gcatgcagggaaggccgctccagcgtggtggacatgctcatcatgagaggggctcgcatc
aacgtcatgaacagaggagatgatacgcccctgcacctggcctccagccacggccacaga
gacatcgtgggcaagctgatccagtgcaaagcagacaccaacactgccaatgagcacggc
aacacaccattgcattacgcctgcttctggggacaggagttagtggctgaggacctggtg
actaacggagctcaggtgaacatctgtaataagtatggagaaactcccctggacaaagcc
aaacctcacctgcgtgaagccctccaagagaaagcagagaagttgggccagagtttgacc
aaggtccccttcaaggacacgttctggaaaggcaccaccagaactcgaccccgtaacggc
acgttgaacaaagccgcgggcatcgacttcaaacagctctccctcctggctaagatcaat
gagaaccagtctggagagttgtggcaaggccgctggcaggggaatgaggttgtggtgaaa
gtgttgaaggttcgtgactggtccaccagaaaaagcagagacttcaatgaggaatatccc
aaactccggatattctcccaccccaatgtgctgcccatgttgggagcgtgtcagtctcct
cctgcccctcaccccatcatcatcacacactggatgccctatggctccctctacaacgtg
cttcacgagggcaccaactttgtggttgaccagacacaggcggtgaagtttgctttggac
attgcctgtgggatggccttcctccacacgctcgagcccatgatctcgcggcactctctc
aacagcaagagtgtcatgatcgacgaggacatgacagccaggatcagcatgtcagacgtc
aagttctccttccagtgtcctggcaggatgtactccccagcatgggtagcccctgaagcc
ctgcagaagaagcctgaggagatcaaccggcggtcagcagacatgtggagcttcgctgtg
ttgctgtgggagctggtgaccagggaggtgcccttcgctgacctctccaacatggagata
ggcatgaaggtggccctggaaggcctacgacccacaattcctccgggcatctcaccccac
atctgcaagctcatgaagatctgtatgaacgaagatccagccaagaggcctaaatttgac
atgatcgtacccatcctagagaaaatgcaggacaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267274
Entry
112267274         CDS       T05605                                 

Definition
(RefSeq) integrin-linked protein kinase-like
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03320  PPAR signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112267274
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    112267274
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112267274
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112267274
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112267274
Protein kinases [BR:otw01001]
 Serine/threonine kinases: TKL group
  MLK family
   112267274
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112267274
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ank_5 Ank_4 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 112267274
NCBI-ProteinID: XP_024301298
LinkDB
Position
14
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSSVVDMLIMRGARI
NVMNRGDDTPLHLASSHGHRDIVGKLIQCKADVNTANEHGNTPLHYACFWGQDPVAEDLV
TNGAQVNICNKYGETPLDKAKPHLREALQEKAEKLGQSLTKVPFKDTFWKGTTRTRPRNG
TLNKAAGIDFKQLSLLAKINENQSGELWHGRWQGNEVVVKVLKVREWSTRKSRDFNEEYP
KLRIFSHPNVLPMLGACQSPPAPHPIIITHWMPYGSLYNVLHQGTDFVVDQTQAVKFALD
IACGMAFLHTLEPMISRHSLNSKSVMIDEDMTARISMSDVKFSFQCPGRMYSPAWVAPEA
LQKKPEEINRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
ICKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggatgatatttttacccagtgccgggaaggcaacgcagtagctgttcgcctgtggttg
gacaacacagagaatgacctgaatcagggggatgaccatggcttcagtcctctccactgg
gcctgcagggaaggccgctccagcgtggtggacatgctcatcatgagaggggctcgcatc
aacgtcatgaacagaggagatgacacgcccctgcacctggcctccagccacggccacaga
gacatcgtgggcaagctgatccagtgcaaagcagacgtcaacactgccaacgagcacggc
aacacaccgctgcattacgcctgcttctggggtcaggacccagtggctgaggacctggtg
actaatggagctcaggtgaacatctgtaataagtatggagaaactcctctggacaaagcc
aaacctcacctacgtgaagccctccaagagaaagcagagaagttgggccagagtttgacc
aaggtccccttcaaggacacgttctggaaaggcaccaccagaactcgaccccgtaacggc
acgttgaacaaagccgcgggcatcgacttcaaacagctttccctcctggctaagatcaat
gagaaccagtctggagagttgtggcacggacgctggcagggaaatgaggtggtggtgaaa
gtgttgaaggttcgcgaatggtccaccagaaagagcagagacttcaatgaggaatatccc
aaactcaggatattctcccaccccaatgtgctgccaatgttgggagcgtgtcagtctcct
cctgcccctcaccccatcatcatcacacactggatgccctatggctccctctacaacgtg
cttcaccagggcactgactttgtggttgaccagacacaggcggtgaagtttgctttggac
attgcctgtgggatggccttcctccacacgctcgagcccatgatctctcgacactctctc
aacagcaagagcgtcatgattgacgaggacatgacagccaggatcagcatgtcagacgtc
aagttctccttccagtgtccaggcaggatgtactccccagcatgggtagcccctgaagcc
ctgcagaagaagcctgaggagatcaaccggcggtcagcagacatgtggagcttcgctgtg
ttgctatgggagctggtgaccagggaggtgcccttcgctgacctctccaacatggagata
ggcatgaaggtggccctggaaggcctacgacccaccatccctcccggcatctcaccccac
atctgcaagctcatgaagatctgtatgaacgaagatccagccaagaggcctaaatttgac
atgatcgtgcccatcctggagaaaatgcaggacaagtga

DBGET integrated database retrieval system