KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267156
Entry
112267156         CDS       T05605                                 

Gene name
atm
Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03440  Homologous recombination
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    112267156 (atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112267156 (atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112267156 (atm)
   04210 Apoptosis
    112267156 (atm)
   04115 p53 signaling pathway
    112267156 (atm)
   04218 Cellular senescence
    112267156 (atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112267156 (atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:otw03032]
    112267156 (atm)
   03400 DNA repair and recombination proteins [BR:otw03400]
    112267156 (atm)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112267156 (atm)
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   112267156 (atm)
DNA replication proteins [BR:otw03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     112267156 (atm)
DNA repair and recombination proteins [BR:otw03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112267156 (atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC DUF3349
Other DBs
NCBI-GeneID: 112267156
NCBI-ProteinID: XP_024301060
LinkDB
Position
14
AA seq 3089 aa
MSLVLHELLVCCRGLENDKATERKKEADRFRQLIRSPDTVEELDRISGTRAAKSSKQLTW
NAVFRFLQKYLQKETELLQSGKANVSATTQANRQKKMQEISSLVKYFIRCANKRGPRLNC
GELLNHVMEVLRSSFSCLAYGEDYSSILLKNILSVRKYWCDITQQQWHNLLDLYCGLFTG
SSKAINRVLVSRIIHTAVQGCCLQTEGFSHTLFSFFSRALLNARQERHLAVVEHLVSALN
VFLRSTAMNCRMRVCRLGEELLPSVLYVWTQMRPCTTLKEEIVEFFNLQLCVHHPKGSKT
QDTGAYAEDWVKWQSLLYNLYDALVSEISQIGSRGKYATGSRHIAVKENLMELTAEICHQ
LFSEDCNFQMLEVTQAHLRATQRGSPHGTPSKRRRIDLGWEVLRDHLQPHHSDFDVIPWL
QITSVLTSKYPSMVPGQELVPLLSVLCQLLGEQRRGDRGPYVLRCLREVARCQATHPERA
QSYRAELGRLWGRVWALALRGVSSPQTEALSLALLSTILQGAFIPIDRELWKLFSGSACK
PSDAAALCLAQALLKCPVLKSLGTGWDHAGAVEGVGPPSLKENIMSWLLMNEQSEEAEES
SRPHPIICRDFPHNLIPRILVPLTLKDTRAGIMFLLGAKGLESAVMQEQAQVEVKGSLSE
IESMYLQFSFDEMPSNPMAKVMVSSAGTQLTVVPSLKHKLEQGLLSVADHLLNCYSPDSQ
TTPPECLVRCSSLLTGVLAGYVSTGLLTEEEACHSQLFLKAKALVQDFSEYISNVKVKIA
EDGTMTTLRSVMRLCTQCVNRGVKDSMSSVSCNLFMKIFPGRLLTELAEICKLLLNSSCK
RGSVGIEEEITDEDWDMTRTQADQQEDIDLFDDGDGPQTSTSKGTHRQNVDPNDTQCGFD
AKSLLAEEHLAQQDLAILASLEFLSLCVSAEFIHGLSFKPVEVRRRLLLLLEQIDCTKPL
HLNMYLVLLKKLPAEDTSLAAEEFDSLLRPLADLCSLYRQDQEVCAAVLLGLLPSIRSLG
RTQDQHNDMRHVQGALLQVVSGFCILGRTGKCTAIVKVALIHCLLALLEADPCCKWAVIT
LREEELPVSVILPSHLSDSHHHVRMLAAMTVERLFLEMTPDSLEKRKMLPLKCQQTAFEN
VYLKAQEGMRLQKNSSPEDLSDETFNRKATLLKSVSVVLCCSPVCEKQSLFALFQSYKEN
NIEEPLIKKVLGSVSRALGYRSVEGFVSSHLDYLVAEWLGQHGYTLESFPYTLLNHATLK
DFYSSSYQVLIPHLVFLDDFKQVKSISTHLGKDWKKLLANCFPKIMVNILPYFAMSGQDA
QVARQREKAHRVYDLLKDSNCLGKPQIDSLIHSNLSDIVVELLMTLYEGAATEEGGRGDL
RRFIGELDPAPNPPYFSSYVIKATLDYLSSCHSANLKSLVAILSKTPISIQRILLAVCQK
AAETINAYERHRILLMYHLFVSLLLKEVKDGLGGAWAFVLRDIIYTLIHHINSRPAQLDE
VSSRSFSLCCDLLTSVCRTAVQFCDDAVESHLQVIVGTLTAQVTTQLAISQQVLSLLKFL
VVESQDKLKSAIQKLEPFPDRPEFRELRAVQHTLKYSTGKFTLRQEIAHFLSVASCDSLP
LTRLEGLKDLRRQLHNNKSQIRPLLRECLADPAESVLVLLVLNLLQLCKLAANHPGGRDI
LEAAGSCLGELGPVDFSTIALLHGKDQLNARAVSLFPSVEPQWLYITLNCINNALTHHCI
EVRQAAVQSLKGILATQAGADFWEIHKDNRDPMLAYLNPFRSTKKKVVGMSEEVSLVARE
RLESQDLWVPEAGSHKAWLKMLCMVLLDSGGVRSEALLLSRPLCLVKTDFCQRVLPLIIH
DILLGDSDGSWRKLLSTHIQDFFTSCFSRARASSRSTTPLPSDSAAESDISNQGPLDKAS
LRTMLSVINYLRQQQRPLGSDSNLCGTVCHSNFWLELNYLEVARAAQSCSAHFTALLYSE
IYVDKIKTNMEENRRNPSRASRRITFDESSQNFTISSLTEESVKDTGISLQDLLIEVYRS
IGEPDSLYGCEGGKMTSALTRIRTYEHEAMWGKALTSYDLHSNLPDGTRQVGIVEGLQNI
GLSSILATYLRGLESEGVEWGAELRELRFQAAWRNMQWDCDLSERNEKLNPGFNESVFCS
LQALRDKEFSTFDQTLNYARGNEVEELCKGSLEAVSSLYPALRNLQRISELESIRQLFSK
PLTDVGLAEVCSHWQQHSQLLVDSDFTLVEPILALRSVAQETLISQERDPEKNKYLSTVL
TSHLMELCQLARAAGNTQLAERAVFQMKQHGGGGGRGSTASSWQLEEAQVFWAKGEQGLA
LGLLRQMIHTLEEQVNVNPALVPVFTECLRLCGNWLAETCLESPGVILEKYLERAVVVIE
GHAIGSDTKLQSQRTQAFLSLARFSDAQYQGIDNYMKSSEFENKQALLEKAKEEVDLMRE
RKVGNNRYTVKVQRELELDERALSNLQADRRRFLCKAVENYIHCLEQGEEHDTWVFRLAS
LWLENADVKTVNDMMKGGVNRIPSYKFLPLMYQLAARMGTKMSATVAEDVGFYGVLNELI
CLSCLEHPHHTLFIILALVNANKDESFSRSRLSKSTPRHSSQLDLERSEVAQGIMKKIRK
KRAQMIRGIEVLCDAYITLAYMDASRHKTEKKAILIPSDQPIMQIKNLDDVIIPTMEIKV
DPSGKYDNLVTIKSFKPHFHLAGGVNLPKIIDCVGSDGKIRRQLVKGQDDLRQDAVMQQV
FHMCSMLLQRNTETRKRKLNIRRYKVVPFSQRSGVLEWCSGTVPIGDFLIDPQKGAHTRF
CPQDWTSITCRKKMMESQRLGSGGKTQAFSEVCQNFRPVFRYFCMERFLDPAVWLEKRLA
YTRSVATSSIVGYIVGLGDRHIQNILIDEQTAELVHIDLGVAFEQGKILPTPETVPFRLS
RDIVDGMGITGVEGVFRRCCEKTMEVMRSSQEALLTIVEVLLYDPLFDWTMNPLKAFYLQ
QQHDEQAELQSTLNSTLGGDILEAHRKSSSDSQSFNKVAERVLLRLQEKLKGVEDGRVLS
VGGQVNLLIQQAMDPNNLSRLFPGWQAWV
NT seq 9270 nt   +upstreamnt  +downstreamnt
atgagcttggtccttcacgagctgcttgtctgctgcagaggtttagagaatgacaaagca
acggagagaaagaaagaggctgaccgcttcagacagctcatccggtctcctgacacagtg
gaggagctggatcgcatttctggaaccagagctgctaaaagttccaagcagctcacctgg
aatgcagtcttcaggtttctgcagaagtatctgcagaaagagactgagctgctccagtca
gggaaagccaacgtgtcagccaccacacaggccaaccgtcagaagaagatgcaggagatc
agcagcctggtcaaatacttcatccgctgtgccaacaagagagggcctcggctgaattgt
ggcgagctcctgaatcatgtgatggaggtgctgcggagctcattcagctgcttggcctat
ggggaggactacagcagcatcctgctcaagaacatcctgtctgtccgcaagtactggtgt
gacatcacccagcagcagtggcacaatttgctggatctgtattgtggccttttcactggt
tcctccaaggccataaatcgtgtgcttgtgagcaggatcatccacactgcagtccagggc
tgctgtctgcagactgagggcttcagccatacactcttcagcttcttctccagagcactg
ctcaatgccaggcaggagagacacttggcagtggtggagcacttggtctctgctctgaac
gtcttcctgaggtctactgccatgaactgccgtatgagggtgtgtcggctgggtgaggag
ctcctgccctctgtgctctatgtgtggacacagatgaggccctgcaccactctcaaagag
gagatagtagagttcttcaacctgcagctctgtgtacatcatcccaaaggatcaaagaca
caagacacaggagcctacgctgaggactgggtcaaatggcagagtctactctataacctg
tatgatgccctggtgagtgagatcagccagattgggagccgggggaaatatgccacaggg
tcgcgccacatcgctgtgaaggagaaccttatggagctgactgcagaaatctgccatcag
ctctttagcgaggattgtaacttccagatgctggaggtgactcaggcccacctcagagcc
acccagagaggcagtccacacggcacgcccagcaagcgtagacgcattgacttgggctgg
gaggttctccgagaccacctgcagccacaccatagtgactttgacgtcataccatggtta
cagatcacatcagtgttgacctctaagtacccctccatggtgcctggccaggagctggtt
cctctgctatccgtcctttgccagctgctgggggagcagcggcggggtgacagggggccc
tacgtgctgcgctgcctgagggaggtggctcgctgccaggccacacacccagagagggcc
caatcctacagggctgaactgggcaggctgtggggccgtgtctgggccctggctctacgg
ggggtcagctccccccagactgaggcactcagtctggccctgctgtccaccatcctccag
ggagccttcattcccattgacagagagctttggaagctcttctctggctcggcctgcaag
ccctctgatgctgctgctctgtgtttggcccaggccctcctcaagtgtcctgttcttaag
agcctgggcactgggtgggaccatgcaggggccgtggagggggtcgggccacccagcctc
aaggagaacatcatgagctggctgctgatgaatgaacagagtgaagaggcagaggagagc
tcaagaccacaccccatcatctgcagggattttcctcataacctcatccccagaatcctt
gtgcctttgaccctcaaagacacccgagctggcattatgtttctccttggagcaaaggga
cttgagagtgctgtgatgcaagagcaagcacaagtggaagttaaaggttccctgagtgag
attgagagcatgtacctgcagttcagctttgacgagatgccctctaaccccatggcgaaa
gtgatggtgtcctcagccggcacccagctcactgttgtccccagccttaaacacaagctg
gagcagggcctcttgtctgtggctgaccacctactcaactgctactccccagattctcag
accacaccaccagaatgcctggttcgttgttcaagtctccttactggcgttttagcagga
tatgtctctactggtctcctgactgaggaagaagcctgccattcccaactcttcctaaag
gccaaggcactggtccaggattttagtgagtacatatctaatgtgaaggtgaagattgca
gaggatgggacaatgaccacactcaggtctgtcatgcggctgtgcacacagtgtgtcaac
agaggggttaaggacagtatgagctctgtctcttgcaacttgttcatgaagattttccct
ggaagacttttgactgaactggcagaaatatgcaaactgttgctgaacagctcctgtaag
agaggtagtgtggggattgaggaggagatcacagatgaggactgggacatgacgaggaca
caggctgaccagcaggaggatattgacctgtttgatgatggagacggaccacagaccagc
acatctaaggggactcacagacagaatgtggaccccaatgacacccagtgtggttttgat
gctaaaagcctactggctgaggagcatttggcccagcaggatttagccatcttggccagt
ctagagttcctgtccctgtgtgtatcggctgagtttatccacgggctctctttcaaacca
gtggaggttcgccgcaggttactactgctgctggagcagatagactgcaccaagccacta
cacctcaacatgtacctggtccttctgaagaaactacctgctgaggacacatcgctggca
gctgaagagtttgactcactcctcagacctctggcggatctttgctcattgtaccgccag
gaccaggaggtctgtgctgcagtgctgctgggtctgctaccgtctatccgtagtctgggc
cgtacccaggaccagcacaatgacatgagacacgtccaaggagctctgctccaagtggtc
tctggattctgcattttgggcagaacggggaaatgcacagcaattgtaaaggtggcatta
attcactgtctactggctctactggaggctgacccttgctgtaagtgggcggtcattacc
ctgagggaggaggagcttccagtgtccgtcatcctcccgtcccacctgtctgactctcac
catcatgtacgaatgcttgcagccatgacagtggaaaggctgtttttggagatgacaccg
gacagcttggagaagagaaagatgcttcctctgaaatgccagcagacagcctttgagaac
gtctacctgaaagcccaagaagggatgaggctccagaagaacagctctcctgaagacctg
agtgacgagacctttaaccgcaaggccacgctgctgaagagtgtgtcggtggtgctgtgc
tgcagccccgtctgtgagaaacagtccctcttcgccctcttccagtcctacaaggagaac
aacatagaggagccactcatcaaaaaggtcctgggcagtgtgtccagagctctgggctac
aggagtgtggaggggtttgtcagctctcacctggattacctggtggcagagtggctgggc
cagcatggctacactctggagtccttcccttacactctgctcaaccacgccactctcaag
gacttctacagctcctcctatcaggtccttatcccacacctggtcttcctggatgacttt
aagcaggtgaagtccatcagcacccacctgggtaaggactggaagaagctgctggccaac
tgcttccctaagatcatggttaacatcctgccctactttgccatgtcgggccaggatgcc
caagtggcccggcagagagagaaggcccacagggtctatgacctactcaaggacagcaac
tgcctgggaaaaccgcaaatcgacagcctgattcacagtaacctgtcagacattgtggtg
gagctgttgatgaccctgtatgaaggggctgctactgaggaggggggcagaggggacctg
agaaggttcataggggaactggacccagccccaaacccaccctatttcagctcctatgtc
ataaaagccacactggactatctcagctcgtgtcacagtgccaatctcaagtccctggtg
gccattttatccaagactccgatctccatccagaggatcctactggcggtgtgtcagaag
gcagctgagacgatcaatgcctacgagaggcaccgcatcctgctgatgtaccacctgttt
gtcagcctgctgctcaaggaggtcaaggacggcctggggggagcctgggccttcgtcctc
cgagacataatttacacactcatccaccacatcaacagcaggccggcccagttggacgag
gtgtccagccgtagtttctccctgtgttgtgacctactgacctctgtgtgtcgcacagcc
gtgcaattctgtgacgatgctgtggagagccacctacaggttatcgttggtactctcact
gcccaggtgacaacccaacttgctatctcacagcaggtgctcagtctgttgaagttcctg
gtcgtagagagtcaggacaagctgaagagtgccatccagaagttagagcccttcccagac
cgacctgagttcagagagctgagggccgtgcagcacacactgaagtacagcacagggaaa
ttcactctcagacaggagatagcccacttcctgtctgtggcttcctgtgactccctgcct
ctgaccagactggaggggctgaaggacctgaggagacaactccacaacaacaagagccag
atcagaccactgctgagagagtgcctcgcggaccctgcagagagtgtgttggtgctgctg
gtccttaacctactacagctctgtaagctagcagccaatcaccctggaggaagagacatc
ttagaggctgcagggagctgtctgggagagctggggcctgtggatttctccaccatcgct
ctgctccatgggaaggaccagctcaatgccagagctgtatcactcttcccttcagtggaa
ccacagtggctctacatcaccctgaactgcatcaacaacgccctcacacaccactgtatt
gaggtgaggcaagctgctgtccagagtctgaagggcatcttggccactcaggctggagct
gacttctgggagatccataaagacaaccgtgaccccatgctggcttacctcaaccctttt
aggtctaccaagaagaaggtggtcgggatgagtgaggaggtgagcttggtggctagggag
cggctggagagccaggacctgtgggtgcctgaggctggcagccataaggcctggttgaag
atgctctgcatggttctgctggacagtggaggggtcaggagtgaagctctgctgctttcc
cggcccctgtgtctggtgaaaacagacttctgccagagggtgctgccgctcatcatccat
gacatcctgctgggggactctgacggctcctggaggaagctcctctccacacacatccag
gactttttcaccagctgtttcagtcgtgcccgggcctctagccgctccaccactcctctc
ccctcagactctgcagcagagtcggacatttccaaccagggtccgttggataaggcctct
ctgcgcaccatgctctctgtcattaactatctgaggcagcaacaaagacctctaggatct
gatagtaacttgtgtggtacggtgtgccactctaacttctggttggagctgaactacctg
gaggtggccagggcagcccagtcctgctcagcccacttcacagccctgctctactctgag
atctacgtcgacaagatcaagactaacatggaggagaaccgcagaaatccgtccagagcg
tcgcgcagaatcacatttgatgagagcagtcagaacttcaccatctccagtctgacagag
gagagtgtgaaagacactggtatcagtctacaggacctactgattgaggtgtatcgtagt
attggggagccagacagtctgtatgggtgtgaaggtgggaagatgaccagcgctctcacc
aggattcggacctatgagcatgaggcgatgtggggaaaggctctgacctcctacgacctc
cactccaatcttcctgatggcacacggcaagtgggcattgtggagggtctgcagaacatt
ggtctgagcagtatcctggccacctacctgcggggtctggagagtgagggggtggagtgg
ggggcggagctaagggagctaaggtttcaggctgcctggaggaacatgcagtgggactgt
gacctatcagagaggaatgagaaattgaaccctggcttcaacgagtcagtgttctgctcc
ttgcaggctttgagagacaaagagttttccacattcgaccaaactcttaactatgccagg
ggcaatgaggtggaggaactgtgcaaaggcagtctggaggcagtgtcctctctctaccct
gctctacggaacctccagaggatcagtgagctggagagcatccgacaactcttctccaag
cccctgaccgacgtaggcctggccgaggtgtgttcccattggcagcagcactcccagctg
ctggtggacagtgactttacgctggtggagcccatcctggccctgcgctccgtggcccag
gagaccctaatctcccaggagagagaccctgaaaagaacaagtacctcagcactgtcctc
acctcccacctcatggagctctgccaactggcccgcgccgcaggaaacacacagctggca
gagcgggcggttttccagatgaagcagcatggcggaggaggggggcggggctccacagcg
tcgtcatggcagctggaggaggcccaggtgttttgggcgaagggagagcagggtcttgct
ctggggctactgagacagatgatccacactctggaggagcaggttaacgttaaccctgcc
ctggtgccggtgttcacggagtgcctgaggctgtgtgggaactggctggcagagacgtgc
ctggagagccctggggtcatcctggagaagtacctggagagggcagtggttgtgatcgag
ggccatgcgataggttcagacaccaagctgcagagccagaggacgcaggccttcctgtcc
ctggccaggttctcagatgcccagtaccagggcattgataactacatgaagtcatctgag
tttgagaacaaacaggctctgctggagaaggccaaggaggaggtggacttgatgagggag
cgcaaggtcggcaacaacaggtacacagtgaaggtgcagagggagttggagctggatgag
agggctctgtccaacctgcaggctgacagaaggaggttcctgtgtaaggctgtggagaac
tacatccattgtcttgagcagggtgaggagcacgacacctgggtgttccgcctggcctca
ctgtggctggagaacgctgacgtcaagacagtcaatgacatgatgaagggaggtgtgaac
aggatcccgtcctataagtttctgcctctcatgtaccagctggctgcccgcatggggacc
aaaatgtctgctacagtggcagaggatgtgggcttctatggtgttctcaatgagctgatc
tgcctgtcgtgtctggagcatcctcaccacaccctcttcatcatcctggctctggtcaac
gctaacaaggacgagagcttctcccgcagccgcctgtccaagagcaccccgcgccattcc
tcccaactggacctggagcggtctgaggtggcccaggggataatgaagaagatcaggaag
aagagagcccagatgatcagaggcatagaggtcctctgtgatgcctacatcactctggcc
tacatggacgccagtcgacacaagacagagaaaaaagccatcctcatcccctctgaccag
cccatcatgcagataaagaacctagatgatgtcatcattcctacaatggagatcaaggtg
gacccctcgggtaaatatgacaacctggtgaccatcaagtccttcaagcctcactttcac
ctggccggaggggtcaacctgcccaagatcattgactgtgtgggatcagacgggaagatc
agacgacaactggtcaagggccaggatgatctgcggcaggatgctgtaatgcagcaggtg
tttcacatgtgttctatgctgctgcagcgcaacactgagacacgcaagaggaaactcaac
atcagacgctacaaggtggtgcccttctcccagcgtagtggggttctagagtggtgctcg
gggaccgtccctataggggatttcctcatagacccccaaaagggcgctcacacacgcttc
tgcccccaagactggaccagcataacctgccggaaaaagatgatggagtctcagaggctt
ggttccggtgggaagacccaggctttcagtgaggtgtgtcagaacttccggcctgtcttc
cggtacttctgcatggagcgattcctggacccggcagtgtggctggaaaaacggctggcc
tacactcgcagtgtggccacttcctccatcgtgggctacattgttggactgggggatagg
cacattcagaacatccttatagacgaacagacagctgaactggtgcatattgatttgggt
gtagcatttgaacagggcaagattctcccaactcctgagactgttcccttcaggctatcc
agagatattgtggatgggatgggcataacgggggtggagggcgttttcagaagatgctgt
gagaagaccatggaggtcatgaggagttctcaagaggccttgctgactattgtagaggtc
ctgctgtacgaccctctgtttgactggaccatgaaccctctcaaggccttctacctgcag
cagcagcatgatgagcaggctgagctccagtccacgctcaactctacactggggggagac
atcttggaagcccaccgcaagtccagcagtgatagccagagcttcaacaaggtggcggag
cgcgtgctgctgcggctgcaggagaagctgaagggggtggaggatggcagggtgctcagt
gtaggagggcaggtcaacctcctcatccagcaggccatggaccctaacaatctcagccgc
ctcttccccggctggcaggcctgggtctag

DBGET integrated database retrieval system