KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267174
Entry
112267174         CDS       T05605                                 

Definition
(RefSeq) vasodilator-stimulated phosphoprotein-like isoform X1
  KO
K06274  vasodilator-stimulated phosphoprotein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112267174
   04530 Tight junction
    112267174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112267174
   04147 Exosome [BR:otw04147]
    112267174
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     112267174
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112267174
SSDB
Motif
Pfam: WH1 VASP_tetra Ran_BP1 SPX
Other DBs
NCBI-GeneID: 112267174
NCBI-ProteinID: XP_024301124
LinkDB
Position
14
AA seq 408 aa
MSESSICQARATVMIYDDGNKMWLPAGTGSQTFSRVQIYHNPSTNAFRVVGRKMQTDQQV
VINCPIVKGLKYNEATPNFHQWRDARQVWGLNFGSKEDAALFASGMAHALEVLNSLADAG
YATLPRPVSNGPSPEELEQQRRLEQQERERQEWERLERERQQAAAVPTPPVPPLAPPAPP
GPPPPPGPPPSGPPPPPGPPPPGPPAAGSGPPPAPPLPSPGGDGGLGGGAGGLATALAAA
KLRRVAKDDSGSVAAASSAAAPAAKPDQSRTSGSIGGGGGGGLMGEMASILARRKKMADG
GAKPPAKTDNDDSESQGQSDTLGRRPWEKSATMPRNNSISKSMDSTSPLPQGPRVKHAGG
SNDAGGGEETDMERIKQEILDEMRKELQKVKEEIIGAFIEELQKRGST
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgagtgagtccagtatctgccaggctcgggccacggtgatgatctatgatgatgggaat
aagatgtggctcccggcaggaacagggtctcagaccttcagcagggtccagatctaccac
aacccctccactaacgccttcagagtggtgggacgcaagatgcagacagatcaacaggtg
gtgattaactgtccgattgtgaagggcctgaagtacaatgaggccacgcccaacttccac
cagtggcgagacgcgcggcaggtgtgggggctcaacttcggcagtaaggaggatgccgcc
ctcttcgccagcggaatggcccatgcactggaggtgctcaactctctggcagacgcaggt
tacgctaccctcccccgcccagtgtcaaatggaccttccccagaggagctggaacagcag
cggaggctggagcaacaagaaagagagcggcaggagtgggagagactggagagagagaga
caacaagctgcagcagtgcccactcctccagtcccaccgttggcccccccagcacctccg
gggccccctccacccccaggacctcctccgtctgggccccctcctccccctggaccacct
cccccaggacccccggccgcaggatcaggacccccgcccgccccaccgctgccctcccca
ggaggagatgggggcctagggggaggtgcagggggcctggcgacagccttagctgcggcc
aagctccgcagagtggccaaggacgatagtggtagtgttgctgctgcttcttctgctgca
gcaccggctgccaagcctgatcaaagccgcaccagtgggtccatcggtggtggtggtgga
ggaggcctgatgggtgagatggcatccatcctggcacggaggaaaaaaatggcagacggt
ggggcaaagccacctgctaagacagataatgatgactcagagtctcaaggccaaagtgac
actcttggaagaagaccatgggagaaatcagccactatgcccaggaataactccatctcc
aagagcatggactccacctctcccttgccccagggtcccagggtgaagcatgcaggtggt
agtaatgatgctggaggtggtgaagagacagatatggagaggattaaacaggagattctt
gacgagatgcggaaggagttacaaaaagtcaaggaggagataatcggagcctttattgag
gagctacagaagaggggttccacatag

DBGET integrated database retrieval system