KEGG   Oligella urethralis: CEQ07_00295Help
Entry
CEQ07_00295       CDS       T05343                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
our  Oligella urethralis
Pathway
our00550  Peptidoglycan biosynthesis
our01100  Metabolic pathways
our01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:our00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEQ07_00295
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CEQ07_00295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:our01003]
    CEQ07_00295
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:our01011]
    CEQ07_00295
Enzymes [BR:our01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CEQ07_00295
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CEQ07_00295
Glycosyltransferases [BR:our01003]
 Polysaccharide
  Bacterial polysaccharide
   CEQ07_00295
Peptidoglycan biosynthesis and degradation proteins [BR:our01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CEQ07_00295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB REC1 DUF1707
Motif
Other DBs
NCBI-ProteinID: AVL70015
LinkDB All DBs
Position
complement(60244..62709)
Genome map
AA seq 821 aa AA seqDB search
MSQKKQSPKVSGFGAFIGRFIIKVLFLGAGLAVCGLIFGTLVVSSVWPNLPNLTAMTDYR
PRIPLRIYSADKILLAEYGEERRNVLRIDEFPEKMKLAILAAEDDNFYEHSGVDWRGVIR
AVLANLSSGGRAQGASTITMQVARNFYLSTEKSYLRKFYELLLTYKIEENLTKDQILELY
MNQIYLGHRSYGFSVAARTYFAKPLSEVSLAEAAVLAGIPKAPSNNNPLTNLQGALDRQH
YVLNRMLRLGYITQAEFDEARAEAVTTRSMAEVESEESARITQAQRQGSYVAELARQLMY
LTYKDNVYGRGLNVYTTIDSKDQAVAYRALRKNIMQFTNNRPYPGPEGQIELAEGVEHDD
KAMEKIIYEVRKSHPNDDDLLVAVVLSSAADKVTLMRRVGEIIELSGKELNNARRALPPK
PNNAKPILRGSIVYIQRFGENGWSIVNQPQVEGAFVALNTKTGAIQSMVGGFNFYRGDFN
RVTQAWRQPGSTFKPFIYAAGLERGLTPETRISDQPFVLTARQTGSKPWQPKNYGGRYTE
SQTMRNGLYQSRNMVSIRILEAVGADFARDYITRFGFDIRRQPQKGAYLTMALGAGNVTP
LQMAGAYAVFANGGYRVNPYIIDYVLDPDGNEIMRAQPQKAGDEANRVLDARTAYVMNDL
LHGVATSGTAARTTGTLGRKDLHGKTGTTNQAFDAWYAGYTRDLVGVAWLGYDQPRSLGS
NATGGQLAMPIWIEYMQTALKGTPVTAPGPLPKGLAKNGGNYYFEEFPQGKAIANLGTRG
GATTGGGGGEAQRFRPIQPRRDPVQRTIESFNPTGGAPIRF
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaaaagcaatcacctaaagtttcaggtttcggtgcctttattggtcgcttt
attattaaagtattgttcctcggcgcaggcttagcagtgtgcgggctaattttcggcacc
ctcgtcgtcagctccgtgtggcccaacttacctaacctgactgccatgacggactaccgt
ccacgcattcccttgcgtatttattccgcagacaaaatcctgcttgccgagtatggtgag
gagcggcgtaatgtcctgcgtatcgacgagttccctgaaaagatgaaattagccatttta
gcggctgaggatgataacttttacgagcattccggtgtggattggcgtggcgtgattcgt
gctgtgttagccaacctctcctccggcggccgcgctcaaggtgccagtaccatcaccatg
caggtggcgcgtaacttctacttaagcactgaaaagtcctacttgcgtaagttttatgaa
ttgctattaacttacaaaattgaagaaaatctgaccaaggatcagatccttgaactctat
atgaaccagatttatttgggccatcgttcctacggtttctcagtggcggcgcgtacctac
tttgccaagcctttatccgaggtcagcttagccgaagcggcagtgttagccggtattccc
aaggccccatcaaacaacaacccgctcaccaatctacaaggtgcgcttgatcgtcagcac
tatgtgttaaatcgtatgttgcgtttaggctatatcactcaagcggagtttgatgaggcg
cgcgccgaggcggtgaccacacgctccatggcggaggtagaaagcgaggagtcggcccgt
attacccaagcccaacgccaaggtagctatgtggcagaactggcacgtcaactgatgtac
ttgacttacaaggacaatgtctacggtcgcggcttaaacgtgtataccaccattgactca
aaggatcaggcggtggcttatcgtgccttacgcaaaaacattatgcagttcaccaataac
cgcccttacccgggaccagagggtcaaattgagttggctgagggggtagagcatgatgat
aaggccatggaaaaaatcatttatgaggtgcgtaaatcgcatcctaatgacgatgattta
ttagtcgcggtggtgctttcttccgctgcggacaaggtcaccttaatgcgccgtgtgggt
gaaattattgagctcagcggcaaggaattaaataacgcacgccgcgccttacctcccaag
cctaataatgctaaacccattttgcgcggttcaatcgtctatattcaacgttttggtgaa
aatggctggagcattgtcaatcagccacaagtcgagggtgcttttgtggcgctcaatacc
aagaccggtgcaattcaatccatggtgggtggctttaacttctaccgcggcgactttaat
cgcgtgacccaagcttggcgtcaacccggttcaacctttaagccctttatctacgctgcc
ggccttgagcgcggtttaacccctgaaactcgcatttcggatcagccctttgtgctgact
gcccgtcaaacgggctccaaaccatggcagcctaaaaactacggcggtcgctacacggag
agtcaaaccatgcgtaacggtctctaccagtcacgcaacatggtctcaattcgtatccta
gaagctgtgggtgcggactttgcccgtgactacatcacccgtttcggctttgatatccgt
cgtcaaccgcaaaaaggcgcatacctcaccatggcgctaggcgctggtaacgtcacgcct
ttacaaatggcaggtgcgtatgccgtctttgctaatggcggttatcgtgtgaatccgtac
attattgactatgtactcgatccggatggtaatgaaatcatgcgtgcccaaccgcaaaaa
gccggcgatgaggccaatcgcgtattagatgcacgtacggcctatgtgatgaatgatcta
ctccatggggtagccacctcggggaccgccgcacgcacgaccggcaccttaggccgcaag
gatttacacggcaaaaccggtaccacgaaccaagcttttgatgcgtggtatgccggttac
acccgtgatttagtgggtgttgcttggttaggctatgaccaaccacgctctttgggtagt
aatgccactggcggtcaattagccatgccgatttggatcgaatatatgcagaccgccctc
aaaggcacacccgtgaccgcccctggccccctacctaagggtttagccaaaaacggcggc
aactactactttgaggagttccctcagggcaaggctatcgctaatctcggcacccgtggc
ggagccacgaccggtggcggtggtggtgaagcgcagcgcttccgccccattcagccacga
cgtgacccggtgcaacgcactatcgagtcctttaacccaaccggtggtgcgcccatacga
ttctaa

DBGET integrated database retrieval system