KEGG   Oligella urethralis: CEQ07_01755Help
Entry
CEQ07_01755       CDS       T05343                                 

Gene name
mrdA
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
our  Oligella urethralis
Pathway
our00550  Peptidoglycan biosynthesis
our01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:our00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEQ07_01755 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CEQ07_01755 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:our01011]
    CEQ07_01755 (mrdA)
Enzymes [BR:our01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CEQ07_01755 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:our01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CEQ07_01755 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AVL70279
LinkDB All DBs
Position
366719..368791
Genome map
AA seq 690 aa AA seqDB search
MFEQRRRIKIERSRNRLRVAVAAVFVLACFTILIYRLWVLQVERYQGFSERADNNRISLV
PITPKRGNIYDRNGEILAHSYRDYTLEVVPGQVKNIDALIEEVSNIIPISALDIRRFKQR
MEANTRYTSIILRSNLTDEEAATFAVRAFKYPGVSIRARWVREYPQGESAAHLIGYIGRI
SEKDRERIEEAGLIGDYRGTDVIGKKGLELSYEKQLHGKPGWEQVEIAASGRPVRVLERS
DPIPGDNLRLSIDMGLQRMIEGVFNDEKNPQRGAVVAIDPRNGQVLAYVSAPSFDPNLFV
DGIDVENWRRLSDSPDHPLIDRPIYGTFPIGSTYKPFIALAALTLNARDAKTRIHDPGYF
EFGGQRFRNAGSAVYGSLDMHRALVVSSDTYFFGLGPILGVDAIHDFAIQFGFGKQTGID
LPHEKKGILPSRAWKQSAFKNPKQQSWFPGETISVAVGQGYNSFTIMQLAQATATLAANG
VYTRPHIVNWLENPSQRRAEQVVRAPEYKIDLRQADIDVIKRALAEVPTHGTARRVFQGT
NYKSAGKTGTAQVFSLRGATYNARNLNKRLHDHALYMGYAPVENPTIAVAVIVENGGWGS
TVAAPIARKVFDYWLADDVQHRNQQSYVPNFLEEGDLSESVSPDIEIPAAPTNLEEEDEQ
QPLPEIVGNPTTNQQTRRRALTPAEGGVGG
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacaaagacgacggatcaaaatcgagcgtagcagaaatcgcttgcgtgttgca
gtggcggcggtttttgtgttggcttgctttacgattttgatttaccgtctttgggtgttg
caggtagaacgttatcagggcttttctgaacgggccgataataaccgtatctccttggta
ccaatcacgcccaaacggggtaatatctatgatcgcaatggcgaaattctggcgcatagc
tatagagattacacccttgaggtggtgcccggacaggttaaaaatattgatgcgctgatc
gaggaagtgtcgaacatcatccctatctcggccttggatatacgtcgctttaagcagcgg
atggaggccaatacccgctatacctcaattattctgcgcagtaatttgacggatgaagag
gcagccacctttgcagtgcgtgcttttaagtacccaggtgttagcattcgcgcgcgttgg
gtgcgagagtatccgcagggtgagtcggctgcacatttaattggctatattggccgtatt
tctgaaaaagaccgtgagcgcattgaggaggcaggcttaattggtgattatcggggcacc
gatgtaattggtaaaaaagggcttgagctcagctatgaaaagcagttgcacggtaagccc
ggttgggagcaagttgaaattgccgcctctggccgcccggtacgggtgttagagcgtagt
gatcccattcccggcgataacctcagactttccattgatatgggactacagcgcatgatt
gagggggtatttaatgatgaaaaaaatcctcaacgtggtgcggtggttgcgattgatccg
agaaatggtcaggttttagcttatgtatcggcaccatcctttgatcccaatttatttgtt
gatgggattgatgtagagaattggcgtcgtttatcggattcacccgatcatcctttgatt
gatcgaccgatttacggtacctttcccattggttctacctataagccttttattgccttg
gctgctttaaccctcaatgcgcgcgatgctaaaacccgtattcatgaccccggttatttt
gaatttggcggacagcgttttagaaacgcaggtagtgcggtgtatggttcgttggatatg
caccgggccttagtggtgtcctcagatacctatttctttggcttagggccgattttgggg
gtcgatgctatccatgattttgccattcagtttggctttggtaagcaaaccggcattgat
ttaccacatgagaaaaaaggtattttaccgtcacgcgcatggaagcaaagtgcctttaaa
aatccgaagcaacaaagctggttcccgggtgagacgatttcagtggcggtagggcagggt
tataactcctttaccattatgcaattagcccaagccacggcgaccttggctgccaacggt
gtttatacgcgtccgcatattgttaattggttggaaaatccgagccaacgacgagccgaa
caagtggtgcgagcgcctgaatataaaatcgatttaaggcaggcagatattgatgtgatt
aaaagggctttggcggaagtgccaacccatggtacggcgcgccgcgtgtttcaaggcaca
aattataaatccgctggtaagaccggcacagcacaggtatttagcctccgtggagccacc
tataatgcgcgtaatctgaataagcgcttacatgatcatgcgctgtatatgggctacgca
ccggttgaaaatcccaccattgcggtggcagtgatcgtagaaaatggcggctggggctct
acggtcgccgcgccgattgccagaaaggtctttgactattggttagccgatgatgtacag
catcgcaatcaacaaagctatgtgccgaatttcttggaggagggcgatctctccgaaagt
gtgtcacccgatatcgaaattcctgcggcaccgacgaatcttgaagaagaggatgaacag
cagccattaccggagattgtcggtaatcccactacgaatcagcaaacgcgtcgccgtgct
ttgacgccggctgagggaggcgttggcggatga

DBGET integrated database retrieval system