KEGG   Oligella urethralis: CEQ07_02275Help
Entry
CEQ07_02275       CDS       T05343                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
our  Oligella urethralis
Pathway
our00473  D-Alanine metabolism
our00550  Peptidoglycan biosynthesis
our01100  Metabolic pathways
our01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:our00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CEQ07_02275
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEQ07_02275
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CEQ07_02275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:our01011]
    CEQ07_02275
Enzymes [BR:our01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CEQ07_02275
Peptidoglycan biosynthesis and degradation proteins [BR:our01011]
 Precursor biosynthesis
  Amino acid ligase
   CEQ07_02275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATPgrasp_Ter ATP-grasp ATPgrasp_ST GARS_A ATP-grasp_4 RimK TTL
Motif
Other DBs
NCBI-ProteinID: AVL70368
UniProt: A0A2X1UPX5
LinkDB All DBs
Position
483027..483977
Genome map
AA seq 316 aa AA seqDB search
MANTTQNLGRVGVIYGGVSAEREVSLNSGAGVHAALLEKGVDAHLFDLGKHSLAELEAQK
FDRVFIILHGRYGEDGCIQGALEIMGVPYTGPGVMSSGVAMDKIMTKRLFIEQNIPTPKY
VEVRDAEDLQAAVKQLGLPMILKPAHEGSTIGLTKIENAEQLDEALAQATQYDKVLLAEE
CIVGRELTVAVLGKGAEAQALPIIEIIAPDGNYDFHNKYHSDETQYICPADLPAELSEKI
KALCVQAYRTIGCEGWSRVDVMLNHANEPYLLEINTAPGMTSHSLVPMAAKAEGMSYPEL
CVKILASADLKVGRKG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggctaatacaacgcagaatttaggtagggtcggtgtgatttatggtggcgtctcggcc
gaacgtgaggtttcgctgaattccggtgctggtgtgcatgcggctttgttggaaaagggc
gtggatgcgcatctctttgatttgggtaagcatagcttagccgagttagaagcacagaaa
tttgatcgtgtctttattattttgcatggtcgttacggtgaggatggttgcattcagggt
gcactggagattatgggtgtgccttatacggggcctggggtgatgagctcgggcgttgcg
atggataaaatcatgacaaaacgtctttttatcgagcaaaatatccccacgccaaagtat
gttgaggtgcgtgacgctgaggatttgcaggcagcggtgaagcagctcggtctgccgatg
attttaaagccagcccacgagggctcaactattggcttaaccaagattgaaaatgctgag
caattagacgaggccttagcccaagcaacgcaatacgataaggtgttattagcggaggag
tgtatcgttggtcgcgagctgacggtggctgtacttggtaagggcgcagaggcacaggcc
ttgcccattattgaaattattgcaccggatgggaattatgacttccataacaaatatcat
tccgatgaaacgcagtatatttgcccagctgatttacctgctgaattaagcgaaaaaatc
aaagcgctatgtgtgcaagcctatcgtaccattggttgtgagggctggtcgcgggtggac
gtgatgttaaatcatgcaaatgagccgtatttattggaaattaatacagcaccaggtatg
acgagtcactctttggtgcctatggctgctaaagctgagggtatgtcctatccagaacta
tgtgtaaaaattcttgcctctgctgatttaaaagtcggtcgcaagggttaa

DBGET integrated database retrieval system