KEGG   Oscillibacter valericigenes: OBV_34480Help
Entry
OBV_34480         CDS       T01636                                 

Definition
(GenBank) putative oxidoreductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ova  Oscillibacter valericigenes
Pathway
ova00020  Citrate cycle (TCA cycle)
ova00190  Oxidative phosphorylation
ova00650  Butanoate metabolism
ova01100  Metabolic pathways
ova01110  Biosynthesis of secondary metabolites
ova01120  Microbial metabolism in diverse environments
ova01130  Biosynthesis of antibiotics
ova01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ova00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OBV_34480
   00650 Butanoate metabolism
    OBV_34480
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OBV_34480
Enzymes [BR:ova01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OBV_34480
    1.3.5.4  fumarate reductase (quinol)
     OBV_34480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Pyr_redox FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAL00647
UniProt: G4KVL4
LinkDB All DBs
Position
complement(3248151..3249665)
Genome map
AA seq 504 aa AA seqDB search
MHRHNIAIAGMGLASLATAARLTELGVKGIAVYANGFGGTPYIAAINFVLPDNPYGDSPE
KYCSDMLRAGYEIGNRTLVEEMTRRTVDGYELLCRWGVTFAHNEDGSVKLRHVSGHTYPR
SLCQTTQLIGEESLKTMLPRLEASGVEIHRNCSVVSLLTDDGKVVGFTVKKGTELSQVYA
PVVVAAWGGAGNLLGKSTYPGDICGNTLGMAKMAGAKMVDMEFLEFEPLVILSPPGVEGE
PSPTAMLGEGGYLRNIEGERFLLKVRPQGEAGASKSLINQEAWKQVQAGKGAPHGGVYLD
LRHVNRKILQSYPWFFNRLMNNGYDPNQQQLEVGPMAHSFSGGICVDCNYASNVQGLYAV
GEACGGLHGACRCAGNAASQAVLSGMLCAEGIAKTAQSNLKIVEYPVAYRCDESVRACVL
PKLQTIGAKSLGIYRNGLDLKAGLLAVQKIINEQNVARDTFTEQCAQAIVMILAAALNRE
ESRGTHNRVDYPETNPAYEKEFVV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtcacaacattgccattgcaggcatgggccttgcttctttagcaacagcggcc
aggttgacagaactgggtgtaaaagggattgcggtttatgcgaacggatttggagggact
ccctatattgcggcaattaattttgttttgccggataatccgtatggagattctcctgaa
aagtattgttcagacatgctccgtgcaggctacgagattggtaatcggacattggtagag
gagatgacccgtcggactgtggacgggtatgaactgctttgtcgctggggggttaccttt
gcccataatgaggatggctccgtgaaattacgacatgtctccggtcatacttacccccgg
tctctgtgccaaaccacacagctgattggcgaggaaagcttgaaaaccatgctgcctcgg
ttggaagcctccggtgtggagattcaccggaattgttcggtggtgagtctactgaccgat
gacggaaaagtcgtcggctttaccgtaaagaaaggaacggagttgtcacaggtttatgca
ccggtcgtcgtagccgcttggggtggtgctggaaatcttctgggcaaatccacatacccg
ggagatatatgcgggaatacgctgggcatggcaaaaatggccggtgcaaaaatggttgat
atggaatttttggagtttgaaccgctggtgattttgagcccgcctggggtggagggagaa
ccatctcccaccgcaatgctgggcgagggtgggtatctgaggaacatcgaaggggaacgc
tttttgctaaaggtccgtccgcagggtgaagcgggcgcttccaaatccttgattaatcag
gaggcctggaaacaggtacaagcagggaaaggcgcaccccacggcggcgtgtatcttgat
ctgcgccatgttaatcggaaaattctgcagtcttatccctggtttttcaaccgcctgatg
aacaatggctacgaccccaaccagcagcagctggaggttggacccatggcccatagtttt
tccggtggtatttgtgtcgactgcaactatgcttccaatgttcagggattgtatgctgtc
ggggaagcctgcggaggacttcacggagcttgtcgatgtgccggaaatgccgcgagtcaa
gcggttctctctggcatgctgtgcgcggaaggaattgccaagaccgcacaatcgaatctg
aaaatagtcgagtatccggtagcctatcgttgtgatgagtccgttcgagcctgcgttctg
cctaaattgcagaccattggtgccaaatcacttggcatttatcgcaatggattggatctg
aaagcgggacttttagctgttcaaaaaattataaatgaacaaaacgttgcccgtgatacc
ttcacagagcaatgtgcacaagcgattgtgatgattctggcagcagcgctgaatcgagaa
gaaagccggggcacccacaaccgagtggattacccggagacaaaccctgcttatgaaaag
gaatttgttgtctga

DBGET integrated database retrieval system