KEGG   Opisthorchis viverrini: T265_03531Help
Entry
T265_03531        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi00052  Galactose metabolism
ovi00500  Starch and sucrose metabolism
ovi01100  Metabolic pathways
ovi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    T265_03531
   00500 Starch and sucrose metabolism
    T265_03531
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    T265_03531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ovi04147]
    T265_03531
Enzymes [BR:ovi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     T265_03531
Exosome [BR:ovi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T265_03531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 GDPD_2
Motif
Other DBs
NCBI-GeneID: 20317718
NCBI-ProteinID: XP_009166307
UniProt: A0A074ZRA4
LinkDB All DBs
Position
Unknown
AA seq 616 aa AA seqDB search
MLRQTCLLLIVFGSSGLPWDELSRLQPQCGPFPISERLDCYPEEGANKDACINKGCCWSA
IDFTEPHIPMCYFPKDYRTYTVRNVTQNPRGFVADMEKIASPYGVNEFQNVRVEVIHETK
TRLRVRFTIPSDPNRWEPPIPLGKPDVDAPEPTDYAVELEKSPFGIRVVRNDPTRQLLLD
STGDLSVSTIFSDQFLQTSFRLGAEHGFGPGEVRADFPHWLRRTWLRMGLWTRDNAPVRE
ANLYGVHNFFMGLSLDGSAFGVFLLNSNAQEVLLTPLPAITYRAIGGILDFFIFTGPNPM
DVTAQYLSLIGHPLLPPYWSLGFHLCRYGYRDSEEVANTVERNVQAGIPLDAQWIDIDYM
DAYRVWTVDPTKFGGLPSLIRDTFHSKYGIRNVLIVDPAVSAKNDPTYVPFLDGLKRGIF
INDSRTGRPIEGVVWPGDTVFPDFSHPEAEAWVYNLASQFHKSVPFDGLWIDMNEPASFA
AGSKTNCDQTSSLDNPPFVPLVLDRSLYAKTVCPSALHHDSTHYNRHNLYGYDHARVTHN
VLKQLFAGKRPFLLRRSSFLWXCARDSQRTQTTVRRKASFPAESFYFFRFWTLYDPLDWR
QLVKLAGYARVNCSDN
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgttaagacaaacgtgcttattgttgattgttttcggtagttctggactcccatgggat
gaattaagtcgcttgcaaccacagtgtggcccgtttccaatttcggaaagattggattgt
tatcctgaggagggggctaataaggatgcatgtattaacaaaggctgttgctggagtgcg
attgatttcactgagcctcatatcccgatgtgttactttccaaaggattacagaacgtat
actgtaagaaatgtcactcaaaacccaaggggctttgttgcggatatggagaagattgcg
tcaccgtatggtgtaaatgaattccaaaatgttcgggttgaagtgatccacgaaacaaag
actcgcttacgtgtgcggtttacgatcccatctgatccaaatcgctgggaaccgccaatc
ccacttggaaagcctgatgtggatgccccagaaccgacagactacgctgtggaactggaa
aaatcaccgtttggtattcgggttgttcgaaacgatccaacccgacaattgttgctggat
tcgactggagatttgtctgtatcgacaattttttcggaccagttcctccagaccagtttc
cgtttgggggctgagcatggtttcggtccaggtgaagtacgtgcagacttcccacactgg
ttacgccggacctggttacgtatgggactgtggacacgtgacaatgcaccagtgagggaa
gcaaacctctacggcgtgcataatttcttcatgggactcagtttagatggatccgcattc
ggcgtgttcttactaaacagcaatgcacaagaagttttgttaactcctttgccagccatc
acttaccgggcaattggtggaattttggacttctttatttttactggacctaatccgatg
gatgtgacggcacagtatttgagtctgattggtcatcctttactcccaccctactggtct
ttgggatttcatttatgccgttatggctaccgggattcagaagaagtggccaacactgta
gaacggaatgtccaggctggtataccacttgatgctcagtggattgatatagactacatg
gatgcttaccgagtttggaccgtagacccaacgaaatttggtgggttaccaagcttaatc
cgagacacttttcattccaagtatggcataagaaatgtcctgatcgtggacccagcagtg
agtgcaaagaatgatcccacgtatgtgccattcctggatggtttaaaacgaggaatcttt
attaatgacagccggacaggtagacccattgaaggagttgtctggccaggagacacagtg
ttccctgatttttcccatcccgaagctgaggcatgggtgtataatttggccagtcagttt
cataagagtgttcctttcgacggtctttggattgacatgaatgaacctgcaagttttgcc
gcaggttccaaaacaaactgcgatcaaacgagttccctagataacccgccatttgttccg
ctcgttctggatcgttcgctctatgcgaaaacagtttgtccatcggctctgcaccacgat
tcaactcactataatagacacaacttgtatggttatgatcatgcgcgcgtgactcacaac
gtactcaaacaactgttcgcaggaaagcgtcctttcctgctgcgtcgttcttctttttta
tggttntgcgcgcgtgactcacaacgtactcaaacaactgttcgcaggaaagcgtccttt
cctgctgagtcgttctactttttcaggttctggactctatacgatccattggactggaga
caacttgtcaagctggccggatatgcgcgcgtcaattgctcagataattaa

DBGET integrated database retrieval system