KEGG   Opisthorchis viverrini: T265_04114Help
Entry
T265_04114        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K06765  deleted in colorectal carcinoma
Organism
ovi  Opisthorchis viverrini
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Neogenin_C Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 20318300
NCBI-ProteinID: XP_009167036
UniProt: A0A075A109
LinkDB All DBs
Position
Unknown
AA seq 1423 aa AA seqDB search
MILTESGPYLQTNHRLTQPKNLQIIPFHFGSFNISWEMESEAERWISHYELVLLNLGEVP
SKEEQLRCGAFLQAHNLTDGSPITQGGSIHDRQLSINVTAPASSVIITGLPPDNFYRVLL
FAMIGSHRSTPASMPSSPRVPALPPLTSPTEVKVTSRGTQAAKVAWRPPVGADCTGELIN
YVITINSTRLIEPLIIKLARDAQSHVVSDLIPGTYYSVQVAATTRGGVGLASVPVHFRTG
GELPRVELDDLDEVEVPLLPEELEEMANENRQYFEGGLARSHWISTGQDALGPDQVYLIP
AKIYNLRATPDQTTIHLKWSVALRRVDPDSEHELFSIMDLDKRPQTMTSDQNRPLRVQLS
GPQSVTAYLPPGTKYIIRWGDMHPGPSEDTVMGDQAEYLIENLHSEHELFSIMDLDKRPQ
TMTSDQNRPLRVQLSGPQSVTAYLPPGTKYIIRWGDMHPGPSEDTVMGDQAEYLIENLHT
GTLSSNGPIIPVNLVVRAVGSTWARVGWELPELPTRLQSQVLLFKIKYYPINVDRSTMQT
FQTGTPSSEATVITVNLSVPLNPTTAASQQSWPFKAVLRGLQPATQYEFGVCLLDPPTEG
ASFHMPVKGQTISPELCWSMVQGFETFGKNPSDAPTNIRISVPREVVDPLAQNEVGGRES
KPSSAKSGVLVRLHWDAPLRANGEIGAYVIYLSADRSKSVNDWSEHTVPGSMNSGNLPGL
QPKQIYFLRMVARNRHGTSPFSPVVAFRTPDSNGQGGGMIRLSKTYYDAREIFEPLDTVI
PAGVDQNQAAGVRPSTNAVDETSGADQLRWIIVGSVLGGTVVIVLVATAVLFSRCRKSRN
SLGIMKRSTSKQPYMPGYPNVYRSDTTSPTDVNTKTASFSLQDPCHGGCSVTGSGAGGSN
SGCHLTGCTLSDNSPVDPRPSSHECSGHHPPGIYRPCLDWSTPNRMHASKCHMTGVEPKC
CAALSDSSGPIWTQLTTVIPGCIDDRHSTTAGSDIDTPGSCSGSSRRFDPGIGRKQSKRN
EGSECCDHGFHGQGGYGLELSSDPFNHDRGEHIQQNNAYRPIANKRRLMNGYRNDIEERS
PDMCVVQQRSIPAPMVAFTGSGSLNDDEAITSSPASSSAGRTSANLPHWSPMRKYHPLGQ
QSAQSGFYPHDKSEPISPQRSRVNHCQMRLDSRNNSDSNKFGGKSSYSSNAGDHGNYGNL
MVTNRVNAMSSDYASQQSSLSESNPKVYAFPTLLVSSNSNRSRIFLTIAGNPSSASSAVG
NGFSPERPFVSKTNIMTTCDQRAKDIGLSFALDRVPTPEPTPRPAPLNRLAGGKMSQPEE
MGNRWNIEKLEDLIGRTKLGPDTATSSPTLVKKAQLSFLGSGQEEIMKNRDGFSHENTPE
TVDSISEKQLVREYSAEELHQEMVNLEGLMKDLNQITQHQFEC
NT seq 4272 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaactgaatctggtccttacttacaaacgaaccatcgtctgacacaacctaaa
aatctgcagattattccatttcactttggatcattcaatatttcttgggaaatggagtcc
gaagctgaacggtggattagtcactatgagctcgtacttctgaacctcggagaagtcccc
tccaaggaagaacagttacgctgcggtgcgtttcttcaagcccataacctgacagatggg
tctcctattacacagggcggcagtatacatgatcgacaattatccattaatgttactgct
ccggcttcatcagttatcatcactgggttgcccccggacaatttctaccgagtcctcttg
tttgcgatgattggatcccatcgtagcacacctgcatcgatgccttcctctccgagagtt
cccgcccttccacctttgacgtcacctactgaggtcaaggttacttctcgtgggacacaa
gccgcaaaagtggcctggagaccaccggttggagccgactgtaccggagaattgatcaat
tacgtgataaccatcaattccacacgtttaatcgaaccgctcatcatcaaactggccagg
gatgctcagagccatgtggttagcgacctgattcctggtacgtactactccgtgcaagtg
gcggcaaccacgagaggtggtgttggtctggcctcagtaccagtccacttccgtacggga
ggcgagctgcctcgagttgaattggatgatcttgatgaggttgaagttccacttcttccg
gaagaattagaagagatggctaatgagaacagacagtacttcgaaggtgggcttgccagg
tcccattggatctcaacgggtcaggatgcactcggaccggatcaggtctacttgattccc
gccaaaatatacaacttacgggcgacgcctgatcagacaaccatacatcttaaatggtca
gttgccctccgtcgtgtggacccagattctgaacatgaactattcagtattatggatcta
gacaaacggccacaaacgatgacgtctgaccagaatcgcccgctacgcgtgcaactttct
ggaccgcagtctgtcacggcctatttgcctccaggcacaaaatacatcattcgctggggc
gacatgcaccccggaccatcggaagacacagtgatgggagatcaggcagaatacttgata
gaaaatttgcattctgaacatgaactattcagtattatggatctagacaaacggccacaa
acgatgacgtctgaccagaatcgcccgctacgcgtgcaactttctggaccgcagtctgtc
acggcctatttgcctccaggcacaaaatacatcattcgctggggcgacatgcaccccgga
ccatcggaagacacagtgatgggagatcaggcagaatacttgatagaaaatttgcatacc
ggaaccctctcatctaacggtccgattatccctgtgaaccttgttgtgcgggctgttgga
tcaacatgggctcgtgtgggttgggaactgccggagctcccaactcgtctgcaatcccag
gtgcttctgtttaaaataaaatactatccaattaacgtcgatcggtccaccatgcagacc
tttcagacaggaaccccttcatcagaggccaccgtgatcacggttaatttgagtgtgcca
ctgaatcccaccacagcggcttctcagcaatcgtggccgttcaaagcggtccttcgaggt
cttcagccggcaacacaatatgagtttggagtttgtttattggatccccctaccgaaggg
gctagtttccacatgccagtgaagggccaaacgatatcccctgagctatgctggagtatg
gtacagggctttgagacttttggcaaaaacccatcagacgcgcctacgaatattcgaatc
tccgtaccacgggaagtagtcgaccccctcgcgcaaaacgaagtgggtggacgtgaaagt
aaaccgtcttcagcgaaatccggtgtgcttgtccgtctccactgggatgcacctttgcgg
gccaatggagaaataggggcctacgtaatctacctgagtgcagatcgatcgaaaagtgtt
aatgattggtcagaacacactgtccctggtagtatgaactccggcaacttacccggtcta
caaccgaagcagatctacttcctgcgaatggtagcccgaaacagacatgggacatcaccg
ttttccccagtggttgccttccggaccccagactctaatgggcaaggaggtggaatgatc
cgattgtcaaagacatactatgatgcccgtgaaatattcgagcctctggatacagtgatt
ccagcgggggttgatcagaatcaggcagctggagttcgcccttcaacaaacgcagtcgac
gaaaccagtggagcggatcaactccgttggattatcgttggctcggtactcggtggtacc
gtggtaatcgtactggttgccacagcggtgctgttcagtcgatgtcgaaagtcgcggaac
tcactggggataatgaaacggtctacctccaagcaaccctacatgccaggctatccaaac
gtgtatcgatcggacacaaccagtcctactgatgtcaacacgaaaacagctagtttctcc
ttacaagatccttgtcatggagggtgcagtgtcactggaagtggagcaggcgggtcgaat
agtgggtgccacctgactggatgtactttatcggacaactcacctgtggaccctaggcct
tcaagtcatgaatgctcggggcatcacccacctggaatctatcgtccctgtttggattgg
tccacaccgaatcggatgcacgcttcaaaatgccacatgacaggagtagaaccaaaatgt
tgtgctgccttatctgactccagcgggcctatttggacccaactgacgacagtcattcct
ggttgtatcgacgacaggcactcgacaactgccggaagcgatatcgatactcccggttcg
tgttctggaagctcacggagattcgatcccggaataggacgaaaacagtccaagcggaac
gaaggttctgaatgttgtgaccatgggtttcatggacaaggtggatacggactggagctt
agctcagacccttttaatcacgaccgtggtgaacacattcagcaaaataacgcataccga
cccatagccaacaaaagacgtttaatgaatggataccgaaacgatattgaagagcgctcc
cctgacatgtgtgttgttcaacagagatcgataccagcccctatggttgctttcaccggt
agcgggagtttgaacgatgatgaggccatcacgtcatcgccggcaagcagttccgccggc
aggacttcagctaacttgccccactggtcacctatgagaaagtatcacccactgggacag
cagtcagcccaatccggcttctatccccatgacaaatcagaaccgataagcccccagaga
agccgcgtcaaccattgtcagatgcggctggacagtaggaacaactccgattcaaacaaa
tttggaggaaagtcctcttactcgtcgaacgccggagatcatgggaattacggaaatttg
atggtcacaaaccgagtgaacgcaatgagctcagattacgcatcgcaacaaagcagtctg
agtgagtctaatcccaaagtgtacgcttttccgacacttcttgtcagctctaattcaaat
cgatcacgcatttttctgactattgcaggcaatccatcgagtgcatccagcgcagttgga
aacggattttcccccgaaagacccttcgtgagcaagaccaacattatgacaacctgcgat
cagcgagccaaggacataggcctttcgtttgctctggatcgtgtcccgactcctgaacca
actccgagaccagctccacttaaccgcttagctggggggaagatgagtcaacctgaggag
atgggaaatcgttggaatattgaaaagttggaagacctaattggcaggacaaaactagga
ccagatactgccacatcatcaccaaccctggtgaaaaaagcccagctatcctttctgggt
tcaggacaagaggaaattatgaaaaatcgggacggattttctcacgaaaacactccggaa
acggtggatagcatttccgaaaagcagttggttcgtgaatatagcgcggaagagctgcat
caagagatggtcaacctcgaaggtttgatgaaagacctaaatcaaatcacacaacaccaa
ttcgaatgttag

DBGET integrated database retrieval system