KEGG   Opisthorchis viverrini: T265_04189Help
Entry
T265_04189        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi04068  FoxO signaling pathway
ovi04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    T265_04189
   04150 mTOR signaling pathway
    T265_04189
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ovi01001]
    T265_04189
Enzymes [BR:ovi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     T265_04189
Protein kinases [BR:ovi01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   T265_04189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Prok-RING_1 ADK_lid zf-RING-like APH
Motif
Other DBs
NCBI-GeneID: 20318375
NCBI-ProteinID: XP_009167135
UniProt: A0A074ZPS3
LinkDB All DBs
Position
Unknown
AA seq 812 aa AA seqDB search
MAESSEALFAILQQRCSLLDSKIKGFNLVNKALQMKTCQLVDFINRQEDCFGLITKEYDE
LSNDINSIQAVIEKYSWELEELKSRIDQYLSTGSSKSNQPLGTNAPNIPQVILPPVTSNY
PPHGQQTNKLRLRAHLPNNQFTLVEVKPGQQIQHALGKKLSHRGLQLQQLVVNRLRSGLP
VSWEDDAVQIALAGEDLIVDFARGSVKRSEHQFQRKTFFDKAHCNLCHKFILHGIICKGC
GAVYHQRCLPRADMTCLAVLEDEVFYSSDLPGARHLPTTSSGSVGSNWLTPKTLATLPHG
AYKRYRNTPGDATVRLPGGSMADAYLHAGFVTPHEHQSRQYLTPTSRERSSSTPNVSNNV
VPPPAGSPYAINSFGKRDAQRSQQQIECSAIGHPYMASGDASSACAVVTNGGVCQSCGHV
HVGGNEAGTAFDGSVSDVKQQSSKSRARRDSNEEWEIPTAEITKGPRIGSGSFGTVFKGY
WHGNVAIKELNVTNPNPQQLEAFKNEVNVLRKTRHTNILLFMGCVSKPCLAIVTQWCEGS
SLYKHLHVLEGRFDIPELVDIARQTSQGMDYLHAKHIIHRDLKSSNIFLHDRTVKIGDFG
LATVKSGWWNSGFQQPTGSIFWMAPEVIRMQGDTPYTNLSDVYAFGIVLYELITGQLPYS
RFNNRDQILFLVGRGLLKPDMSEVRSDIPIDLTQLTVECCSFERYDRPAFSQIYQRLDSL
YRSLPKLQRCSSEPTLNAARFERPDTCELTAYLNVSPKTPLNSVITDNVFFFSDRSKEVS
LAVPGLTKDKRPMEQLLEEDSKNPLEPSETDS
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagtagtgaagctctcttcgccattctgcagcaacgctgcagtctgctagat
agcaaaattaaaggcttcaacctcgtcaacaaggccttgcaaatgaaaacctgtcagcta
gttgatttcatcaacaggcaagaggactgtttcggcttgattaccaaagaatatgatgag
ctttccaacgacatcaacagtatccaggctgtcattgaaaaatattcttgggagttagag
gaactcaagtccagaattgaccagtacctttcaaccggaagttcaaagtccaatcagcct
ttgggtacaaacgcaccgaacattccacaggtcattctgccaccagttacttcgaactat
cctccccacggacagcagacgaacaaactacggcttcgagctcatctacccaacaatcag
ttcaccttagtcgaagtaaaacctggacagcaaattcaacacgctttgggaaaaaaactc
tcccacagagggctgcaacttcagcaactggtagtcaatcgacttcgttcaggtttacct
gtatcctgggaggatgacgccgtccagatcgcacttgccggagaggatttaattgtggat
tttgccagaggcagtgtaaagcgctcggaacatcaatttcagcggaaaaccttttttgac
aaggcacactgcaatctctgccacaagttcatacttcacggtattatttgcaaaggttgt
ggtgcggtgtatcatcagcgctgccttcctcgagctgatatgacttgcctcgccgtgttg
gaagacgaagttttctacagtagtgatctacctggtgcgcgacatttgccgaccacttcg
tccggttctgttggatccaactggctaacccccaaaaccctcgcgaccctacctcatggt
gcctacaagcgatatcgaaacactccgggcgacgccacggtgcgtctgccaggaggcagt
atggcggacgcctatctgcatgccggcttcgtcacacctcacgagcaccagtctcgccag
tatctaaccccaaccagcagggaacggtcttcctctactccaaacgtctcgaacaatgtg
gttcctcctccagcagggtctccttacgccattaactcttttggcaagcgtgacgcacaa
cgatcgcagcaacagattgaatgcagtgcaataggacacccatacatggcctctggcgat
gcctcatccgcttgtgcagtagtgaccaacggaggagtgtgtcagtcctgtggtcatgtt
cacgttggcggcaacgaggcaggaaccgcgtttgacggaagcgtatctgacgttaaacag
caatcctcgaaatctcgggcccgccgcgactccaatgaggaatgggaaatacctacagca
gaaatcaccaagggcccacgcattgggtctggatcgtttggaacggtgttcaagggctac
tggcatggaaatgtggcaattaaagaactgaatgtcaccaatcccaacccacaacaactg
gaggcgtttaaaaacgaagtcaatgtgctcagaaaaacgcgtcacacgaacattctcctt
ttcatgggttgtgtctccaagccctgccttgcaatcgttacacagtggtgtgagggttcc
agtctttacaagcatctgcacgtgctcgaaggtcgctttgacattcccgaattggttgat
attgctcgacaaacttcacaaggaatggattatttacatgcgaaacacatcattcatcga
gacttaaagtcgagcaacatctttttgcatgaccgaactgtgaagattggggatttcgga
ctggccactgttaaaagcggctggtggaatagtggatttcaacaaccaacgggttccata
ttctggatggcacctgaggtcattcgaatgcagggcgatacaccatacaccaatttgtcc
gatgtttatgcatttggtatcgtcctgtacgagctaatcaccggccagctaccttacagt
cgattcaacaaccgtgaccagattttgttcctggttggtcgtggtcttctgaagccagat
atgagcgaggtgaggtcggatattccgatcgacctaactcaactaactgttgagtgttgc
agtttcgaacgatatgacagacctgcattctcacagatctatcaacgcctggacagctta
tatcgatccctacccaaacttcaacgttgctcctcagagcctacgttgaatgcagcgcgc
ttcgaacggcccgacacctgtgaattgacggcctatttgaacgtgtccccaaaaactcca
ctgaattccgtcataaccgacaatgtgttctttttttccgatcgctccaaagaagtgtca
cttgcggttcctggattgacaaaagacaaacgtccgatggagcagttgttggaggaggat
tccaaaaatcctctggaaccctctgaaacggattcttaa

DBGET integrated database retrieval system