KEGG   Opisthorchis viverrini: T265_05581Help
Entry
T265_05581        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
ovi  Opisthorchis viverrini
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ovi01001]
    T265_05581
Enzymes [BR:ovi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     T265_05581
Protein kinases [BR:ovi01001]
 Non-receptor tyrosine kinases
  ABL family
   T265_05581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 20319763
NCBI-ProteinID: XP_009168897
UniProt: A0A074ZJX2
LinkDB All DBs
Position
Unknown
AA seq 1713 aa AA seqDB search
MGGTTGKLAPSKNGSVHQSKTVSHGTSMDLSNHGLNSMDQGSLSLFDRNYFMLRTTERAD
DSVSRLNVSGIVPVEKEIMVVLYDFTESMKSQITIKRVTPLVGAAFRSSCSGFACRICSS
RGADILNYLKITLQAWTPSLPGYLQCPQAGQQGALALTLELIEIDLCCLRNNNSRCKHGE
LVRLLSYSPAGDWSEVETSGLAHPATHPLSDVENNHATGANHFPSHTGSDSSSHRDAPGA
QSATSSVGGGSNSGSQIKYRRGWVPTSYLAPAHVLLSDPVQNTRHLIGQTSHQMLVSPAT
TLFQGPHADGVGDAIGDSQPNLVSRHPKHTVSSAGPQTVLSVTSTLDSSPVGIHGPGLSA
YPWYHGAVSRQAGEQLLRFGITGSFLVRASESAPGQLSVTVRHLGRVYHYRISQDARGMF
YITNVHRFPTVVQLIDHHSRSADGLVCPLLYPVPKTPTSTQAPYSSILAHPFVPLLPLPP
NSGLHPTHASPNASNILGEALTESALRHAPLHLQRGRGTVIPESGLVNHPGVPAPQGTLA
ANAFTDDASSNRMLALDEWEINRAEIVMRQKLGCGQYGDVYEAIWKRLNVVVAVKTLKQD
VNLNVNDFLKEAAIMKRLRHRNLVQLLGVCTREPPLYLITEYMPNGNLLNYLRGRSPGEL
TPPILLYMAVQIASGMSYLESSNFIHRDLAARNCLVGERHLIKVADFGLARYMQLQDTYT
ARNGAKFPIKWTAPEGLAYYVFSSKSDVWAFGVVLWELATYGLSPYPGVELHDVYHLLEK
GYRMERPHGCPEAVYSIMLRCWEWDASLRPSFFEVHAELERMYATMNIEAEVARELEKKR
QPTLPNPPQLLQPAVQRQISCPINSSAEPRTDWDSAVFAPVPPFSNIPSSNAPVSQPWSS
VGQVGASNNVLLGPLSGSTACAANSFHSDGQQSRLDATGRQQRVDGGQFDDSEDEEEEED
ENEEEEEEENDEDEEFWSRRMQAVMGFENKVPGSIADAGRFVDPRSRSTDNGLSLPKNSV
CERRQSMSLTPSSAANTSISNGNHFPTACVVSPTGMRHTGTSALPVKVSQQDANLYQPSI
CNSSSAIQRVSTKRPPTTVEFPPKNASLCPVPAIPSGGVKCVGGGKTSVRAGRHHRRVTD
AAVGQPVHLAGLQQNGTTRSRDTDTPDESGVGESIISNESPADSGGGVVGSTLGPAQPDP
RVSVRPAWSKSNDLPYRSDTKPKPAAFDLPATHRTPANRKCDSNTALSSDADLRRDMPQL
LHMTTASSQPLLRLSPEAMEQFATLPPQDRIGRYLESLNEMHRDNSLGTTRAQVMVDANT
NPTANESLVFLNYPPPPPPQPDPSSSPPSQFSSTGGRPFLHLSLSNQPDCTDSTNTHSHF
VGRIAEERSANDHCGTEHLLNPQPNNPKESPVVDSVHTVVESDKKTRTPLANVSACRIPR
SRRRGAKPDWNAMGRGQDVLHARTDSADCSGEDSNTEEVQRSPDDETLSVVSDSPMGNHR
KRSPTPNVDENDSSVEGDDVYQAPDACYSLLTDNPLSPLLSKPSYDACLGTLIERLEKLI
AWSAPFASMDCGRHRSALHPSSTELFEYFTSLNAYRTDLEVFLRSKEDCWKTSPERVFTA
CNLLESQTNKLSLEFDRADLEKPMTDDIPPVVETLASSVHPALEALLKQLVLFNESTVVD
TREFHPKPTTTSTTSYSRSGACLVSNSVAYGHV
NT seq 5142 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggactacggggaagctggctccttcgaagaatggatccgtacaccagtccaaa
actgtttcgcatggaacttcaatggatctgtcaaaccatggtctcaacagcatggatcaa
ggtagcttgagcctatttgaccgaaactactttatgttgcgtaccacagagcgcgccgac
gactccgtaagccgtttgaacgtttctggcatcgttcctgtggaaaaggagataatggta
gtcctatatgatttcacagaatccatgaagtctcagatcacaataaaacgagtaactccc
cttgtaggcgcagcattccgttcgtcttgcagtggttttgcctgcaggatctgctcgtct
cgtggcgctgacatcctcaattacctaaaaatcactcttcaagcctggacgcccagtcta
cctggctaccttcaatgtccacaagcaggacaacaaggtgctcttgctctcacgctggaa
ttgattgaaattgacctgtgctgtctcagaaacaacaattcaagatgcaagcatggtgaa
ttagtgcgcctgttgagctacagtcccgcgggagattggtctgaggttgaaacttccgga
ctggctcatccggcgactcatccactgtctgacgtggagaacaatcatgctaccggggca
aatcattttccgtctcacaccggatcggacagtagctctcaccgcgatgcaccgggtgct
cagagtgcgacaagttctgtcggtggaggcagcaattcaggaagccagatcaaataccgg
cgtggatgggtcccaacgagctatctggctccggctcacgtgctgttgtctgatccggta
caaaacacacgtcatctgataggccaaacgtcgcatcagatgcttgtatcacctgcgact
actttgtttcaaggacctcacgccgatggtgtcggcgatgcaataggggattcccaacca
aacctagtttccagacatcccaaacacactgtttcaagtgcaggtcctcagacagtttta
tcagtaacatctaccctggacagctctccggtcggtattcatggtccaggattgtctgcc
tacccctggtatcatggtgctgtgtctcggcaagccggcgagcaacttctccgattcggt
attacaggatcttttttggtccgtgcttcggaatctgctcccggtcaactctctgtcact
gttcggcacttgggacgagtatatcattatcggatcagccaagatgcgcgtggcatgttt
tacatcaccaatgttcatcgatttcccaccgtggtccagttgatcgaccaccattcacgt
tccgccgatggcttggtctgtcccctgctgtacccggttcccaaaactcccacttcaact
caggctccctactcctccatccttgctcacccgttcgttcctttactcccactgccaccc
aattctgggctgcacccaactcacgctagtcccaatgcctctaacatcttgggcgaggcg
ttgaccgaatcagcacttcgtcacgcaccacttcatctgcaacgtggtcggggcactgtg
ataccggaatcaggtctggttaaccacccaggcgtacctgctccgcagggaacgcttgcg
gcgaatgctttcacagacgacgcatcatcaaatcggatgttagccctggacgaatgggag
atcaatcgagctgagattgtcatgcggcagaaactgggctgtggccagtacggtgatgtg
tacgaggctatatggaagcgactgaatgtcgtagtcgcagttaaaactctcaagcaagac
gtcaatttgaacgtgaacgacttcctcaaagaggctgcaatcatgaagcgtttacgccac
cgaaacctggttcaattgcttggtgtttgtacgcgcgaaccaccactctatcttatcact
gaatatatgccaaacgggaatcttctaaactacctccgtgggcgcagtcccggtgaactc
acaccaccgattctactctacatggctgtccagatcgcctcgggcatgtcgtacctggaa
tccagcaacttcatccacagagacctcgctgcgcgcaactgcctcgtcggtgaacgtcat
ctgataaaagttgcagatttcggtcttgcccgctatatgcagttgcaggacacctacacc
gcaaggaatggcgccaaatttcccatcaaatggactgccccagagggtttggcctattat
gttttctcatccaagtcagacgtttgggctttcggagtggtgctgtgggaattggccact
tatggcttgtctccttatccaggcgttgaactgcacgatgtctatcatttgctcgagaaa
ggatatcgcatggaaagaccacatggctgccctgaagccgtctactcaattatgctgcgt
tgttgggaatgggacgccagcttacgaccttcattctttgaagtgcacgctgaattggaa
cgaatgtatgcgacaatgaatatagaagctgaagtggcccgtgaactggagaagaaacga
caacccacccttcccaatcctccgcaattacttcaaccggcggtgcaaagacaaatttca
tgtccaatcaacagctctgcggagcctcgaaccgattgggattccgccgtgttcgctcct
gttccacctttctccaacataccatcctcaaatgcaccggtctcgcaaccctggtcttct
gtgggtcaggtaggtgcttccaacaacgttttgcttggtcctttaagcggttctaccgct
tgtgcggcaaattcgttccactcggacggacaacaatcccgtttagatgcaactggtagg
cagcagcgggttgatggaggtcagttcgatgacagcgaagatgaggaggaggaagaagat
gagaacgaagaagaggaagaggaagagaacgatgaggacgaggaattttggtccagaaga
atgcaagcggtcatgggatttgagaacaaagtaccgggttcaatagctgatgccggtcga
tttgttgacccacgaagccgctcaactgataacggtttgagcttacccaaaaactcggtg
tgtgaacgaaggcaatcgatgtccctgactccttcttctgcagccaatacgtccatctcg
aacggaaatcacttccccactgcctgtgttgtttcccccacagggatgcgccatactggc
acatcagcgctgccggtaaaagtcagtcaacaggacgccaacctgtatcaaccttccata
tgcaattctagttcagctattcaacgtgtgtccactaaacgaccgcctacaactgtcgaa
tttccacccaaaaacgcctctctctgtcctgtaccggctatcccatccggtggggtgaaa
tgtgttggcggtggtaagaccagcgtgcgagctggtcgacatcatcgccgtgttaccgac
gctgccgtcggtcagcctgtccatttggctggactgcagcagaatggaacaacccgaagt
cgagacacggacactccagatgaaagtggcgtcggtgagtcaatcatttcgaacgagtcg
cctgcggacagtggtggtggcgtagttggttcgacactcgggccagcacaacctgatcct
cgcgtttctgttcgtcctgcgtggtccaaaagtaatgatttgccttatcgttcggacacc
aaacccaaacctgctgcattcgatcttcccgcaactcaccgtactccagcaaatcggaaa
tgtgactcaaacactgccttgtccagtgatgcggacctgagacgcgatatgccacagctg
ctccatatgacaactgcctcttcacaaccgttgctgcgtttgagtccggaagcaatggag
cagtttgccacattgcctccacaagaccgcatcggtcgttatcttgaaagtctgaatgag
atgcatcgtgataactcactcggcactacacgtgctcaagtcatggtcgatgctaacacc
aacccaactgccaatgagtctctagtgttcttaaactatccaccaccacctcctccccaa
ccagacccgtcatcctcaccaccctcacagttctcttcaacaggcgggcgaccattctta
cacctctctctgtccaaccaaccagactgcaccgattcaactaatacacattcacatttt
gtcggccgaatcgcggaagaacgttccgccaacgaccattgtggaacagaacatttattg
aatccacaaccgaacaatccgaaagagtcaccagtcgtagattctgtacacacagtcgtc
gaatcggacaaaaagacgcgcacccccctggccaatgtgtcggcctgcagaatcccaaga
tctcggcgtcgtggagccaagccggactggaatgctatgggacgcggacaagatgtactg
catgcacgaactgattcagccgactgctccggagaggattcaaacaccgaggaagtgcag
cgctctccggatgacgaaacactctcggttgtgtcagattcacccatgggaaatcaccgt
aagcgatcgcccactcctaacgtagatgaaaacgactcaagcgtcgaaggtgatgatgtt
taccaggcaccggatgcctgttactctctgcttactgacaatccgctgtctccgctactg
tcaaaaccttcatatgacgcatgtctgggcacgttgatcgagcgactggagaaattgatc
gcttggtctgcaccgttcgcttcaatggattgcggacgacatcgatctgcactccatccg
tcttctactgaacttttcgagtattttacctctcttaatgcctatcgtacggatctagag
gtgtttttgcgttctaaagaagattgctggaagacgtccccggagcgtgttttcactgca
tgcaatttgcttgaatcacagacaaacaaattatcacttgagtttgacagagcggacctt
gaaaagccgatgacagacgacatacctccagtagttgaaactctcgcatcatccgtccat
ccagctttagaagcactcctgaagcagcttgtcctttttaatgagtccaccgtggtcgac
acgcgggaattccacccaaaacccaccaccactagtacaacttcatattcacgctctggt
gcctgtctagtttcaaattctgttgcctatggtcacgtgtga

DBGET integrated database retrieval system