KEGG   Opisthorchis viverrini: T265_07596Help
Entry
T265_07596        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi00330  Arginine and proline metabolism
ovi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    T265_07596
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ovi04147]
    T265_07596
Enzymes [BR:ovi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     T265_07596
Exosome [BR:ovi04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   T265_07596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 20321775
NCBI-ProteinID: XP_009171424
UniProt: A0A074ZN93
LinkDB All DBs
Position
Unknown
AA seq 655 aa AA seqDB search
MQVEPLKSLQQKIINDEANRSFTKKHLTNRIVDQYADKKTSFGGSLAQCVSHNARNPRCI
LPRACDLDAYEAFREFFDAVIIDYHKISTALKNLTGEYKGTYYPLTGMKEEDRKKLVEKH
FLFRDDDSVLRDAGGYIDWPNGRGIFINDKENFLVWINEEDHIRVISMQKGGDLIAVYKR
LANAISELGKTLTFATSDRFGFITFCPSNLGTTLRASVHARVPYLSALPNFEQICEKYNI
QARGTHGEHTASVGGVYDLSNKRRLGLTEIEAVTEMYNGVQALLDLEKQLADYNKDAPAG
VMPVEPLPYLSRLLEAADPVKNYTRKHLTPEVIKKYDGVRTTHGATVAHMVRNGAYNPHS
ICPRTGEAECYTKFVDYLDAVILDYHGVNDPAFKHPPPTFGDLNNLPFGDVDPEGKFVVS
TRVRVGRSVDGFLFSTIMSKQDRLDLETKVSTALKSLTGEHAGSYHPLANMSEATRKQLV
EDHFLFKNDDPVLRDAGGYRDWPHGRGIFHNANKTFLVWLCEEDHMRIISMQKGGDLAAV
YKRLIQGIQAIEKTLPFAHSDKYGYITCCPSNLGTTMRASVLLKIPKLSAQKAKLDEVCA
KYRLQARGLHGEHTESPEGIHDISNKRRLGLTELEAAKEMADGVAQMIAIEKSLP
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcgagccactgaaatctctgcagcaaaagataataaacgatgaagccaatcga
tctttcacgaagaaacacttgacaaataggattgttgaccagtatgccgacaagaaaact
tcctttggtggttcgctcgcacagtgcgtcagtcacaatgctcgtaatccgcggtgcatc
cttcctcgcgcttgtgatttggatgcttacgaagctttccgggagttcttcgacgccgtt
attatagactaccataagatttccacagcactaaaaaatttgaccggcgaatacaagggc
acttactacccgttgactgggatgaaggaagaagatcgtaagaagctggtggagaagcac
tttcttttccgcgacgatgacagcgtgttgcgcgatgccggtggttacatcgactggccg
aatggacgtgggatattcatcaacgacaaagaaaatttcctggtttggataaatgaggag
gatcatatccgtgtgatttctatgcaaaagggtggggatctgatagccgtttacaaacgt
ctcgcaaacgcgatttcagaattgggcaagacactgactttcgcgaccagtgatcgattt
ggttttatcaccttctgtccctccaatctggggactactcttcgcgccagtgtgcatgct
cgtgtcccctacctgtcagctctgccgaatttcgagcaaatatgtgaaaaatacaacatt
caggcccgaggtactcatggtgaacacaccgcgtctgtgggtggtgtctacgatttgagt
aacaaacgccgtctcggtctgactgagattgaagccgtcacggagatgtacaatggtgtt
caagccctccttgatcttgaaaagcagttggctgattacaacaaggacgctcctgctggt
gttatgccggttgaaccgcttccctatctgagccgccttttggaagctgcggacccagtg
aagaactacactcgcaaacatttgactccggaagtcattaagaaatacgatggcgtacgc
actacgcacggtgccactgttgcacacatggttcgtaacggtgcttacaacccacattca
atctgtccgcgtacgggagaagctgaatgctatacaaagtttgtcgactacctggatgct
gtgattttggactatcatggagtgaatgatccagctttcaaacacccaccgccaactttc
ggggacttgaacaatctaccctttggtgacgtcgaccctgaaggcaaatttgtggtgtct
acgcgtgttcgggttggtcgcagtgtcgatggattcctattctcaaccattatgagcaag
caggatcgtttggatttggaaacaaaagtttcaaccgccctcaaaagtctcacaggtgaa
catgccggttcctaccatccgctggctaacatgtctgaagccaccaggaaacagctcgtg
gaagaccatttcttgttcaaaaatgacgatcctgtgctccgtgacgccggtggatatcga
gactggccccatggacgtggtattttccacaatgccaacaagaccttcttggtctggttg
tgtgaagaagaccacatgagaattatctctatgcaaaaggggggagatttagcagctgtg
tacaaacgactcatccagggtattcaagccatcgaaaagacactaccatttgcacacagt
gataagtatggttatataacctgttgcccgagtaatttgggaaccacaatgcgcgctagc
gttttgctcaagattcccaagctgagtgcacaaaaagccaagctggatgaagtctgcgcc
aaataccgtctacaagctcggggtctccacggagaacacactgaatcgccagaaggcatt
cacgatatcagtaacaaacgacgtcttggtttgaccgagttggaagctgccaaggaaatg
gccgacggtgtcgctcaaatgattgctattgaaaaatccttgccataa

DBGET integrated database retrieval system