KEGG   Opisthorchis viverrini: T265_08952Help
Entry
T265_08952        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    T265_08952
Enzymes [BR:ovi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     T265_08952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu RVT_1
Motif
Other DBs
NCBI-GeneID: 20323131
NCBI-ProteinID: XP_009173159
UniProt: A0A075A6N0
LinkDB All DBs
Position
Unknown
AA seq 307 aa AA seqDB search
MSTVIPILKKGTRTLCENHRGISLLAVESKVLSGLILRRLTEHRERQIRENQAGFRPARG
CIDHIFTLQQILEQRHCFQQPTMVVFLDLKAAFDSVDRQALWHCLWSKGVPHKFLNLIKA
LYANSRGRLKVYGKLSPEFITSSGVRQGCPLSPFLFNFVIDTIMEDALPASSACGVEVEN
GPVTVDVHITGLTPGKHGFHVHVFGDTTNGCVSAGPHFNPTGVDHGAPEDPVRHVGDLGN
VEANAQGVAQHVFTDKVISLSGPNSIVGRTMVVHEGEDDLGRGGHEFSKTTGNAGGRLAC
GVIGIAQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagttatccctatcttaaaaaagggtacacggacgctatgcgaaaaccaccgt
ggcatcagcctgttagctgtggaatcgaaggtgctctctggtcttatccttcgaaggttg
actgaacacagggagaggcagatccgtgaaaaccaagctgggttccgtcctgcaagaggt
tgcatcgaccatatcttcaccctccaacagattctggaacagcgacactgcttccagcaa
ccaacaatggttgtttttcttgatctgaaagctgcctttgactctgtggaccgccaagca
ctatggcattgtctgtggagcaaaggtgtccctcataaattcttgaacctcattaaggcg
ctgtacgccaactcccgcggccgtttaaaggtctacgggaagctttctcctgagttcatc
acatccagtggtgtccgacagggctgtcctctttcccctttcctcttcaacttcgtcatc
gatacgatcatggaagacgcactaccagcctctagtgcctgtggggtcgaagttgaaaac
ggacctgtcacggtcgatgttcacatcacgggcctcacacccggcaaacatggttttcac
gtccatgtgtttggcgacacgacaaatggttgtgtgtctgccggaccccacttcaacccg
accggagtagaccatggtgcaccggaggatccggttcgtcatgtcggcgatcttggtaat
gtcgaagccaatgcccaaggtgttgcccaacacgtattcaccgacaaagtcatttctctc
agcggccccaactccatagttggtcggacgatggttgtacacgaaggggaggatgatctt
ggacgaggaggtcacgaattcagcaaaaccactgggaacgccggtggacgtctggcctgt
ggtgtcatcggaatagcgcagtag

DBGET integrated database retrieval system