KEGG   Opisthorchis viverrini: T265_15668Help
Entry
T265_15668        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi00020  Citrate cycle (TCA cycle)
ovi00190  Oxidative phosphorylation
ovi01100  Metabolic pathways
ovi01200  Carbon metabolism
Module
ovi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ovi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ovi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    T265_15668
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    T265_15668
Enzymes [BR:ovi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     T265_15668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 20329833
NCBI-ProteinID: XP_009177174
UniProt: A0A074ZV60
LinkDB All DBs
Position
Unknown
AA seq 674 aa AA seqDB search
MTFSVLRPMHIKALQSFANQARLISRPLLRSKASSTKDYTVIDHTFDAVVVGAGGAGLRA
AFGLANEGFKTACITKLFPTRSHTVAAQGGINAALGNMEPDDWRYHMYDTVKGSDWLGDQ
DAIHYMCEQAPHAVIELENYGMPFSRLENGKIYQRAFGGQSIDYGRGGQAHRCCAVADRT
GHSLLHTLYGRSLRYDTNYFIEYFALDLLMENGACRGVIAICLEDGTLHRFRAKNTVLAT
GYFSLLKIKTFINVVAMAEHTFLAHLLIHAPVMALRWLHGLVCPMRIWNSFSFTQQVTWN
LPQFLGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPNAKDLASRDVVSRSMTIEIRE
GRGVGPRKDHIFLQLSHLPAEQLHARLPGISETAKIFAGVDVTRDPIPVLPTVHYNMGGI
PTNYKGQVITYDAATKKDKVVPGLYAAGEAACASVHGANRLGANSLLDLVVFGRSCALDI
ASKHRPGDPGPELKADSGEASIANLDKLRHANGSHSVAEVRLEMQRTMQEYAAVFRDGPT
LQEGCKRMYDLYASRMGDLKVSDRSLIWNSDLIEGLELQNLMLNALQTIVSAEARKESRG
AHAREDFVKRIDEFDYSKPLEGQTAKPMSDHWRKHTLSYQDVNTGKVTLEYRPVIDATLD
AKECPTVPPKIRSY
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgacattttcggtcttgcgtcccatgcacatcaaggctcttcagtcgtttgcaaatcaa
gccaggctgatttctcgccctttgctacgcagtaaagcatcatcaacgaaggactatacg
gtcatcgatcacacgtttgatgcagttgttgtcggcgcagggggcgcaggcctccgtgct
gcattcggtctggccaacgaaggcttcaaaaccgcgtgcataaccaaacttttcccgacg
cgttcgcacacggtggccgcccagggtggaataaatgctgccctggggaacatggaacca
gacgactggcgttatcatatgtacgacaccgttaaggggtccgattggcttggtgatcaa
gatgcgattcactatatgtgtgaacaggctccacatgctgtgattgagctggaaaattat
ggaatgccattcagtcgtctagagaacgggaagatatatcaacgtgcttttggcggtcag
agtatagattacggcagaggtggtcaagcgcatcgctgttgtgctgtcgctgatcggacc
ggtcactcgctcctgcacacgctttatgggcgatcgttacgttatgatacaaactacttc
atagagtattttgcacttgatcttctaatggagaatggtgcttgccggggtgtgattgct
atatgccttgaggatggtacccttcatcgattccgtgcaaagaatactgtcttggctaca
gggtattttagcttgttgaagattaaaacttttataaatgtagtggctatggccgagcat
acttttcttgcacatctgctcatacatgcaccggtgatggcactgcgatggctacacggg
ctggtgtgcccaatgaggatatggaattcgttcagtttcacccaacaggtaacttggaat
cttcctcaatttttaggtatttatggtgccgggtgcttgattactgaaggatgtcgcggt
gaaggaggctatctaattaatagcgaaggtgagcggtttatggaacgctatgcacccaat
gcgaaggacttggcctcccgcgacgttgtgtcaaggtcaatgacgattgaaatccgagaa
ggccgtggtgttggtcctaggaaagatcatatcttcctccagttgtcacacttgccggcg
gaacaacttcatgctcgtcttccgggtatctcagaaactgccaagatcttcgcaggggtt
gatgttactcgcgaccccatccctgtgttaccaactgttcactataatatgggcggcata
ccaactaactacaagggtcaggtgatcacatatgacgctgcgacaaagaaggacaaagtt
gtccccggactgtatgctgccggtgaagctgcttgtgcatcggttcatggcgcgaatcgt
cttggtgccaactctctgctcgatctggttgtcttcggcagatcttgtgcgcttgacatc
gcttctaagcatcgtccgggcgatccgggtcctgagctaaaagctgactccggagaggcc
tccatcgcaaacttggacaaactccgacacgccaatggatctcactctgtcgcagaggtc
cgtcttgaaatgcagcgtacaatgcaggagtatgctgctgtgttccgcgatggaccaacc
cttcaagaaggatgcaaacgaatgtacgacctgtatgcttcgagaatgggtgatttgaag
gtgtctgaccgtagtctgatatggaactccgatctgatagagggtctggaactacagaac
ctcatgctaaatgcccttcagacaatagtcagcgctgaggctcgcaaggaatcgcgcggt
gcgcacgcacgtgaagactttgtcaaacgtatcgatgagttcgactactcgaaacctcta
gaagggcagacggctaagccaatgagtgatcattggcgaaaacacactttgtcttatcaa
gatgtaaatactgggaaagtcacattggaatacagacccgtgattgatgccacactggat
gcgaaagaatgcccaactgtcccgccgaaaattcggtcttattag

DBGET integrated database retrieval system