KEGG   Oxynema sp. AP17: HCG48_21770
Entry
HCG48_21770       CDS       T06528                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oxy  Oxynema sp. AP17
Pathway
oxy00010  Glycolysis / Gluconeogenesis
oxy00020  Citrate cycle (TCA cycle)
oxy00620  Pyruvate metabolism
oxy01100  Metabolic pathways
oxy01110  Biosynthesis of secondary metabolites
oxy01120  Microbial metabolism in diverse environments
oxy01200  Carbon metabolism
Module
oxy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCG48_21770
   00020 Citrate cycle (TCA cycle)
    HCG48_21770
   00620 Pyruvate metabolism
    HCG48_21770
Enzymes [BR:oxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HCG48_21770
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase GCV_H PASTA MadL
Other DBs
NCBI-ProteinID: QIZ72899
UniProt: A0A6H1U5J7
LinkDB
Position
5445607..5446917
AA seq 436 aa
MIHEVFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGILAEIV
VPAGEVAPVGAAIALLAETEAEIEQAKQKAAQLQGSAAQSAAPAASAPSAAPSASQGAAP
AQTTASPSRRNGRTIASPRARKLAKEYQVDLSGLQGSGPHGRIVAEDVEAAAGKAPQPSA
PPVAPPATVPASPAAIAPTPAPAAPPTPTPAPLGEVVSFNTLQQAVVRNMLAGWQAPVFH
VSYTITTDNLDRLYQQIKSKGVTMTALLAKAVAVTLQKHPVLNARYTEKGIEYPSAINVA
VAVAMPDGGLITPVLKSADGQDIYSLSRNWKDLVNRARVKQLQPDEYSTGTFSLSNLGMF
GVSSFDAILPPGQGSILAIAAARPQVVASDDGSIRVCRQMQVNITCDHRVIYGSHAAAFL
QDLAALIENDPQSLTL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgattcacgaagtttttatgcctgctctcagttccaccatgactgaaggaaagatcgtt
tcctgggagaaatccccgggagataaggtggaaaagggagaaacggtggtggtggtcgag
tctgacaaagccgacatggacgtagaatctttttacgaagggattctcgccgagatcgtc
gttcctgcgggagaagtagctccggtgggggcggcgatcgccctgttggcggaaacagaa
gccgaaatcgaacaagccaagcagaaagcagcccaactgcaagggtctgcggctcaaagc
gccgcccctgctgcttcggctccgtctgccgccccgtcagccagtcagggtgcagcccct
gcccagacgacagcgagtccttctcgtcgtaacggacgcacgatcgcctcgcctcgcgcc
cgcaagttagcgaaagaatatcaagtcgatttgagtggcttgcaaggaagcggcccccac
ggtcgcatcgttgccgaagatgtggaagcggcggcgggcaaagcgccccaacccagtgcg
cccccggtggctcctccggcaacagtcccggcgagtccggcagcgatcgccccgacgcca
gccccggcagctcccccgacgccaacccccgcccccctcggcgaggtggtatcgttcaat
accttgcagcaagccgtagttcgcaatatgctcgcggggtggcaagcgcctgtcttccac
gtcagttatacgataacgacggataatttagatcggctctaccagcagattaagtctaaa
ggggtgacgatgaccgccctgctggcgaaagcggtcgcggtcactttgcaaaaacacccc
gttctcaacgcccgttatacagaaaaggggatcgagtatccttcggccattaatgttgcc
gtggcggtagcgatgcccgatggcgggttgattaccccggtgttgaaaagtgccgacggt
caggatatttattctctgtcgcgcaattggaaagacttggtcaatcgcgcccgggtcaaa
cagttgcaaccggacgagtacagtacaggcacctttagcctgtcgaatttaggaatgttc
ggcgtcagcagttttgacgcgatcttgccgccgggtcaagggtcgattttggcgatcgcc
gccgctcgtcctcaagtggtggccagcgatgatgggtcgatccgcgtctgtcgtcagatg
caggtcaatattacttgcgaccaccgggtaatttacggctctcatgcggcagcgttcttg
caagatttggcggcgttaattgagaacgatccccagtccctaacgctgtaa

DBGET integrated database retrieval system