KEGG   Prosthecochloris aestuarii: Paes_0211Help
Entry
Paes_0211         CDS       T00732                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00500  Starch and sucrose metabolism
paa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Paes_0211
Enzymes [BR:paa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Paes_0211
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Paes_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: ACF45268
UniProt: B4S3S2
LinkDB All DBs
Position
219336..222653
Genome map
AA seq 1105 aa AA seqDB search
MPKTRTTGQPEPQWYKDAIIYEAHVKTFFDSNNDGVGDFEGLRQKLPYLESLGITAIWLL
PFYPSPLRDDGYDIADYMDINPDYGTIDDFRAFLNEAHERGLKVITELVINHTSDQHAWF
QRARRAEQGSDERNFYVWTDDPKKYSETRIIFQDFESSNWTWDPIAGQYFWHRFYHHQPD
LNFENPSVEKALYKVLDYWLEMGVDGLRLDAVPYLYEEEGSNCENLPRTHEFLKRLRKHV
DDKFPNRMLLAEANQWPEDAAEYFGDGDECHMNFHFPLMPRMYMALEMEDRFPIIDILDQ
TPEIAETCQWASFLRNHDELTLEMVTDEERDYMRRVYAHDPKARINLGIRRRLAPLMSND
RRKIELMNIMLLSLPGTPVLYYGDEIGMGDNFYLGDRDGVRTPMQWNGDRNAGFSRANPQ
QLQLPVIIDPEYHYEATNVEVQDSNINSLLWWTRHMLSTSRRYKALSRGDIRFIACQNPQ
ILIFSRTFEDETMLCIINLSRNAQAATVDLSEYEGHTPEEVFSLSHFPGITSRPYTVTLG
PYGYFWFKLIRTEEEIGSRRYVDKPFAQVASLKDLFAGKALERLETKVLPEYIRGCRWFG
GKARKIVRVSVEEHIPVTACDNTVYMIVEVRYPSGSNDTYQLPVTFLPAGEFNPDDDYFL
KQVVCSVKIGDEEGYLCDSAYQKSFHSFLLDTIVSSKGLKGSTGKLTGEKGSRVEEFLET
QDDGEMNSVLFGAEQSNTSIMYGDRLCLKIYRKISSGVSPEVEICRMLTEKTSFESSPAY
LGALHFTRSRKDQCSLGILQNFIPNEGDAWSQTLHFVHRYYEDVLVMLPQISEVPVLPST
GGESVEMPEIIHGLIGEPYLEMVSRLAERTAGMHLALASPDLGQDFIPEPFTTLYQRSIY
QSMREQVKRGMVLLREQMGGVAEEYQGLAAGLLKREGEILEQLSHIKARKIAASKIRIHG
DYHLGQVLWTGKDFVIIDFEGEPARSLSERRIKRSAFRDLAGMMRSFHYAAFNVLIQDRS
IRQEDVERLEPWAELWSFYTGQHFFDVYEDAVRGQGLIPEDVKEQHLLLRAYLMDKAIYE
LNYELNNRPEWVGIALKGLSRLLEL
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaacacgcacaaccggccagcctgagccgcaatggtacaaggatgccatcatt
tatgaagcgcatgtcaaaacattttttgacagcaacaatgacggtgtcggtgattttgag
gggcttcgtcagaagctgccctatcttgaaagtcttggtattacggcgatctggctgttg
ccgttttatccttctccgctgagagatgatgggtatgatattgccgattatatggatatc
aatcccgattacggtacgatcgacgactttagagcatttctcaatgaagcgcatgagcgc
gggctgaaagttattaccgagctggttatcaaccatacctccgatcagcatgcatggttt
cagagggcccgtcgtgcagaacagggctccgacgagcgcaatttctatgtgtggactgac
gatccgaaaaagtattcggaaacacggattattttccaggacttcgagtcgtcaaactgg
acttgggacccgatcgccggacagtatttctggcatcgtttctaccaccatcagcccgat
cttaattttgagaacccctcggttgaaaaggcgctctacaaggtgcttgactactggctg
gagatgggtgtggacgggttgcgccttgacgctgtaccgtatttgtacgaggaagagggc
tccaactgcgagaacctgccgcgtacgcatgagtttttgaagcgtcttcgcaagcatgtc
gacgacaagttccctaaccggatgctgcttgccgaggcaaaccagtggcctgaagatgct
gccgagtatttcggggatggcgacgagtgccatatgaattttcattttccgctcatgccg
aggatgtatatggccctggaaatggaggaccgttttccgatcatcgatattctcgaccag
acgcccgagattgccgaaacctgccagtgggcttcgttcctgcgtaaccacgatgagctt
accctcgaaatggtgaccgatgaggagcgcgactacatgaggcgggtctacgctcatgat
ccgaaggcaaggatcaatctcggtatccgccgcagacttgcgcccctgatgtcgaacgac
cggcgcaagatcgaactgatgaacatcatgctgctttccttgccgggaacaccggtactc
tattacggtgacgagatcggcatgggggataacttctaccttggagaccgtgatggtgtg
cggacccccatgcagtggaacggggaccgcaatgccggtttttcgcgggccaatccgcaa
cagctgcagctgcccgttattatcgaccccgagtatcactacgaggcaaccaatgtcgag
gtgcaggacagcaacatcaactctcttctgtggtggactcgtcacatgctctcaacctcg
cgccgttacaaggcgctgagccgtggagatatacgctttatcgcatgtcagaatccccag
atcctgattttcagcaggacttttgaggatgaaacgatgctttgtatcatcaacctttcc
cgtaacgcccaggcggccacggtcgatctgtcggagtatgagggccatactcccgaggag
gtgttcagtctcagccacttcccaggcattacgtcgaggccctatacggtaacgcttggc
ccgtacggttatttctggttcaagctcatcaggaccgaagaggagatcggctcacgccgc
tatgttgacaagccctttgctcaggttgcttctctgaaggaccttttcgccggtaaagcc
ctcgaacgtcttgaaacgaaagttcttcctgaatatatcagggggtgcaggtggttcggt
ggcaaagcgcgcaagattgtcagagtgagtgtcgaagagcatattcctgtgacggcatgc
gacaacacggtctacatgattgtcgaagtacgttatcccagcgggtcgaacgatacctat
cagcttccggtgacgtttctcccggctggagagttcaatcctgatgatgactactttctc
aagcaggtcgtctgcagcgtaaaaataggtgatgaggagggttatctctgcgattcggct
tatcagaaatcgttccacagcttcctgctcgataccattgtcagcagtaaggggctgaaa
ggatcgaccggtaaactgacgggtgaaaagggttcccgtgttgaagagtttcttgaaacc
caagacgatggagagatgaattccgtgcttttcggggccgagcagagcaatacgtcgatc
atgtatggcgacaggctttgcctgaagatctatcgtaagatctcttcaggggtttctcct
gaggtggagatctgccgtatgctgacagaaaagacatcgttcgaaagttcgcccgcgtat
cttggtgcccttcattttacccggagccgtaaagaccagtgctccctcgggattctgcag
aatttcattccgaacgagggtgatgcatggagccagacgctgcatttcgtgcatcgttat
tacgaagatgtgctcgtcatgctgccgcagatttcagaggtacccgtcctcccatctacc
ggaggagagtctgtcgaaatgccggaaattattcatggccttatcggagaaccttacctc
gagatggtgtcgagactggctgaaaggactgccggaatgcaccttgcactggcctcaccg
gaccttggtcaggactttatcccggaacccttcaccacgctttaccagcgttcgatctat
cagtccatgagggagcaggtgaagcgcggcatggtgcttctgcgcgagcagatgggaggt
gtcgctgaagagtaccaggggttggctgccgggcttttgaagcgcgaaggggagatcctc
gaacaactgtcgcatatcaaagcccgcaagatcgccgcgtccaagatccggatccatggc
gattatcatctcggtcaggtactgtggaccggtaaggactttgtgattatcgattttgag
ggcgagcctgcccgatcgttgagcgaacggcgtatcaagcgttcagcgttccgtgatctt
gcaggtatgatgcgttccttccattatgcggcattcaacgtgctgattcaggatcgttcg
atcaggcaggaagatgttgaacgacttgagccgtgggctgaactgtggagcttctatacc
gggcagcacttcttcgatgtctacgaagatgccgtcaggggacaggggctcattcctgaa
gatgttaaggagcagcatctgcttcttcgcgcttatcttatggataaggcgatttatgag
ttgaactatgagctgaacaaccgtcctgaatgggtcgggattgcgctcaagggtctcagc
aggctgctcgagttgtag

DBGET integrated database retrieval system