KEGG   Prosthecochloris aestuarii: Paes_1195Help
Entry
Paes_1195         CDS       T00732                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
paa  Prosthecochloris aestuarii
Brite
Enzymes [BR:paa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Paes_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACF46224
UniProt: B4S837
LinkDB All DBs
Position
1301716..1302321
Genome map
AA seq 201 aa AA seqDB search
MAYQQPSLPYAENALEPYISANTISFHYGKHHATYVKKFNEMVAGTPLDQQSIEEVVKTV
AGDASKAGIFNNGAQAWNHSFYWNCLSPDGGGKPSGSLADKIDQDFGSYDTFREELANAA
ATQFGSGWAWLVLDNGTLKVTKTANAQTPVTEGMTPILTIDVWEHAYYLDYQNRRPDYVA
SLIDNLVNWDFATSNFEAAGA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcataccaacaaccttcgctaccatacgctgaaaacgctcttgaaccctatatttca
gccaacaccatcagcttccactacggaaagcatcatgcaacatatgtcaagaagttcaat
gaaatggttgcaggcacaccattagaccagcaaagtatagaagaggtcgttaaaactgtt
gccggagatgcctccaaggccggtattttcaataacggcgcacaggcatggaaccacagc
ttttactggaactgtctctctcccgacggcggaggaaaaccatcgggaagcctcgccgac
aagatcgaccaggatttcggcagttatgacacgttccgtgaagaactcgccaatgcagct
gcgactcagtttggaagcggatgggcctggcttgtcctcgataacggaacgctcaaagtg
accaaaaccgccaatgcacagacccctgtcactgaaggcatgacccccatcctcactatt
gatgtgtgggagcacgcctactaccttgactaccagaacaggcgccctgattatgtggcc
agtctgattgacaatcttgtcaactgggacttcgcaaccagcaacttcgaagctgccggt
gcgtaa

DBGET integrated database retrieval system