KEGG   Pyrococcus abyssi: PAB1475Help
Entry
PAB1475           CDS       T00024                                 

Definition
(GenBank) porA pyruvate synthase subunit porA (EC 1.2.7.1) (pyruvate oxidoreductase alpha chain) (pyruvate ferredoxin oxidoreductase)
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pab  Pyrococcus abyssi
Pathway
pab00010  Glycolysis / Gluconeogenesis
pab00020  Citrate cycle (TCA cycle)
pab00620  Pyruvate metabolism
pab00640  Propanoate metabolism
pab00650  Butanoate metabolism
pab00680  Methane metabolism
pab00720  Carbon fixation pathways in prokaryotes
pab01100  Metabolic pathways
pab01110  Biosynthesis of secondary metabolites
pab01120  Microbial metabolism in diverse environments
pab01130  Biosynthesis of antibiotics
pab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1475
   00020 Citrate cycle (TCA cycle)
    PAB1475
   00620 Pyruvate metabolism
    PAB1475
   00640 Propanoate metabolism
    PAB1475
   00650 Butanoate metabolism
    PAB1475
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAB1475
   00680 Methane metabolism
    PAB1475
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAB1475
Enzymes [BR:pab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAB1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DUF4290
Motif
Other DBs
NCBI-ProteinID: CAB50268
UniProt: Q9UYZ4
LinkDB All DBs
Position
complement(1320531..1321718)
Genome map
AA seq 395 aa AA seqDB search
MPIRTVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVANGELDAEFIKVESEH
SAISALVGASAAGVRTFTATASQGLALMHEVLFIAAGMRLPIVMAIGNRALSAPINIWND
WQDTISQRDTGWIQFYAENNQEALDLILLAYKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQEVVDEFLGEYEPKHAYLDPKRPITQGTLAFPAHYMEARYLVWEAMENARKVIDEAF
AEFEKKFGRKYQKIEEYRTDDAEIIFVTMGSLAGTLKDWVDKKREEGYKVGAAKMTVYRP
FPVEEIRELAKKTKVLAFIEKDISMGLYGAVFTDASAALINESEKPLMLDFIAGLGGRDV
TFNQLDEALSIAKEALEKGKVEKPIHWIGLRKELL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaggacagttatgaaggctaacgaagctgcagcctgggctgccaagcttgct
aagccaaaagtaattgcggcattcccaattactccatcaacactcgttccagaaaagatt
agtgagttcgttgcaaacggggaattggatgcagagttcataaaggtggagagcgagcac
tcagctatctcggccctagttggagcgagcgcagctggggtaagaactttcacagctact
gcctctcagggattagccttaatgcatgaggttctcttcatagccgctggaatgaggtta
cccatcgtcatggcaataggtaacagagctttaagcgctccaattaacatctggaacgac
tggcaggacacaattagtcaaagagataccggctggatccagttctacgctgaaaacaat
caggaagctttggacttaatcctgttagcttacaaagttgcggaggatgagagggttctc
ctacccgcaatggttggatttgatgcgttcatattgacacacacagttgagccagtggag
attccagatcaggaggtcgttgatgagttccttggagagtacgagccaaaacacgcttac
ctagatccaaagaggcctataacccagggaaccctagcattcccggcccactacatggag
gctagatacctagtctgggaagccatggagaacgcaaggaaggtaatcgatgaagcattc
gccgagttcgagaagaagtttgggaggaagtaccagaagattgaggagtatagaacagac
gatgccgagataatcttcgtaaccatgggttcactcgctggaacgctcaaggactgggtt
gataagaagagggaagagggatacaaggtaggagcagcgaagatgacggtttacaggcca
ttcccagttgaggagataagggagctagctaagaagacgaaggttctagcatttatagag
aaggacataagcatgggactctatggtgcagtcttcactgatgcgtctgcagccctaata
aacgagagcgagaagccactaatgctcgacttcatagccggtctcggtggaagagacgtc
acatttaaccagctcgacgaggcattgagtatagccaaggaagccttagagaagggtaag
gttgagaagccaattcactggattggattaaggaaggagctcttgtga

DBGET integrated database retrieval system