KEGG   Pyrococcus abyssi: PAB2342Help
Entry
PAB2342           CDS       T00024                                 

Definition
(GenBank) Hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pab  Pyrococcus abyssi
Pathway
pab00620  Pyruvate metabolism
pab00680  Methane metabolism
pab00720  Carbon fixation pathways in prokaryotes
pab01100  Metabolic pathways
pab01120  Microbial metabolism in diverse environments
pab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAB2342
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAB2342
   00680 Methane metabolism
    PAB2342
Enzymes [BR:pab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PAB2342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: CAB48939
UniProt: Q9V2Q9
LinkDB All DBs
Position
complement(12209..13618)
Genome map
AA seq 469 aa AA seqDB search
MIPRIMSTQHPDNYSIPFFANSPVLGGEDEITEAFYAFNVLGADEQMWDFEGKEVDEFVV
KKLLERYPSFFRKVILGKDVRLTPRVPNPTVEKAEAKLLLETLQGITRAADYARVFYGED
IAPIFEVILPMTTSLAEIERVHELYRKVVNLADERIYDTTVKEWIGEFYPKEIGIIPLFE
TKVALLKSAKIIGEYLERREPEYQRVFLARSDPAMNYGLISAVTYVKNALQEIWELEEET
SIPIYPIVGVGGPPFRGGMRPDNVDNVLSEYPSVQTYTVQSSFKFDYPTKEVVKAVEKVK
STKRKEPYSLEVPDFITLYEVEYQRQVKILAPHIRRLATRIPDRRKRKLHIGLFGYSRNV
GGLSLPRAIKFTASLYSIGVPPELLGLNALTDRQLDVVSEYYVNIYEDLEFAMRFFSFRV
AEKAGLKELVERIKEFKPEIEEEYVAEAEIVFRGEGDIIKLAQMRGFLG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatacccaggataatgagcactcaacatccggataactactcgataccattctttgcg
aattcgcctgttctcggaggggaagacgagataacggaagctttctatgcattcaacgtc
ttaggtgcagacgagcagatgtgggattttgaagggaaagaagttgacgaatttgtggta
aagaaacttctcgaaagatatccatctttcttcagaaaggttatcctgggaaaggatgtt
aggttaaccccaagggttccgaacccaaccgttgaaaaggccgaggcgaagttgctcctc
gaaacccttcaagggataacaagggccgcagattatgcaagggtattctacggggaagac
atagcgccgatatttgaagttatcctacccatgacgacgagtttggccgaaattgagcga
gtgcatgagctgtatagaaaggtagttaacctggcggatgagaggatatatgacacgacg
gtgaaagagtggatcggtgagttttacccgaaagaaatcggaataatacctctctttgaa
actaaagtagctctcttaaagtcagcaaaaataataggtgagtacttggaaaggagagaa
ccagagtatcagcgagttttcctcgctagaagtgatcctgctatgaattacggtctaatc
tcggcggtgacgtacgtcaaaaatgccctccaagaaatttgggaactggaggaagaaact
tcgattccaatttatccaatagtcggagtgggtggtcctccatttaggggaggaatgagg
ccagataacgttgataacgttctcagtgaatacccgagtgttcaaacttacacagtccag
agtagcttcaagttcgattacccaactaaggaggtagttaaggctgttgaaaaggttaaa
tccacaaagagaaaggaaccttattcacttgaagtacccgattttataacactctatgaa
gttgagtaccagaggcaggtgaaaatcttagctccccatataaggaggttggcaacgaga
attcccgacaggagaaagaggaagctccacataggtctcttcggttattcaaggaacgtt
ggaggactgtcccttccgagggccataaagtttactgcctctctgtattcgataggggtt
ccacccgaattgctaggcttaaacgccctcacggatagacaactagatgtagtttcggag
tactatgtgaacatatacgaggacttagaattcgcaatgaggttcttcagctttagagta
gctgagaaggctggccttaaggagctagttgagaggattaaagaatttaaaccagagatc
gaggaggagtatgtagctgaagctgagattgtgtttaggggagagggggatattattaaa
ttggctcagatgagaggatttctgggatga

DBGET integrated database retrieval system