KEGG   Pyrococcus abyssi: PAB2382Help
Entry
PAB2382           CDS       T00024                                 

Definition
(GenBank) tdh threonine 3-dehydrogenase (EC 1.1.1.103)
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
pab  Pyrococcus abyssi
Pathway
pab00260  Glycine, serine and threonine metabolism
pab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAB2382
Enzymes [BR:pab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     PAB2382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: CAB50292
UniProt: Q9UYX0
LinkDB All DBs
Position
complement(1340696..1341742)
Genome map
AA seq 348 aa AA seqDB search
MSEKMVAIMKTKPAYGAELVEVDVPKPGPGEVLIKVIATSICGTDLHIYEWNEWAQSRIK
PPQIMGHEVAGEVVEVGPGVEGIEVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVD
TDGVFAEYAVVPAQNVWKNPKSIPPEYATLQEPLGNAVDTVLAGPISGKSVLITGAGPLG
LLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVMDITDGNGVDVF
LEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVSIDFNNLIIFKALTVYGITGRHLWETW
YTVSRLLQSGKLNLDPIITHKYKGFDKYEEAFELMRAGKTGKVVFMLK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaagatggtagctatcatgaagacgaaaccggcttacggcgctgagctcgtc
gaggttgatgttccaaagccaggacctggggaggttctaataaaagttatagcgactagc
atttgtggaacagacctacacatctatgagtggaacgagtgggcccaatcaaggataaag
cccccacagataatgggtcatgaggttgccggtgaagtagttgaggtgggcccgggagtt
gagggaattgaggttggagattacgtaagcgttgaaacccacatagtttgtgggaaatgc
tacgcgtgtagaaggggacagtaccatgtttgtcaaaacacgaagatattcggtgtagac
accgatggtgtatttgctgagtacgcggtggttccagctcaaaacgtttggaagaatcca
aagtcaattcctccggagtacgcaacccttcaagaaccacttggaaatgcagttgatact
gttctggccgggccaatctctggaaagagcgttttgataactggagctggcccccttggc
ttacttggaattgcggtggcgaaggcctccggggcttatccggtgatagtttccgagccg
agcgatttcaggagagagctagctaagaaggtcggtgcagattacgtgataaatccattc
gaggaagacgtcgttaaggaagtcatggacataacggatggaaatggagttgacgtgttc
cttgagttcagcggagctcctaaggctttagaacagggacttcaggctgttacaccagct
ggaagagtatccctcctgggcctttacccagggaaggttagcatagacttcaacaatctg
ataatcttcaaggctctaactgtttatggaatcacaggtaggcacctctgggagacatgg
tacacagtttctaggctactccagagcggaaagcttaacttggacccaataataacccac
aagtacaagggattcgacaagtacgaggaagccttcgagctaatgagggctggaaagacg
ggtaaggtagtcttcatgctcaagtga

DBGET integrated database retrieval system