KEGG   Pelagibaca abyssi: Ga0080574_TMP1180Help
Entry
Ga0080574_TMP1180 CDS       T04681                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
paby  Pelagibaca abyssi
Pathway
paby00473  D-Alanine metabolism
paby00550  Peptidoglycan biosynthesis
paby01100  Metabolic pathways
paby01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paby00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ga0080574_TMP1180
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ga0080574_TMP1180
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Ga0080574_TMP1180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paby01011]
    Ga0080574_TMP1180
Enzymes [BR:paby01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ga0080574_TMP1180
Peptidoglycan biosynthesis and degradation proteins [BR:paby01011]
 Precursor biosynthesis
  Amino acid ligase
   Ga0080574_TMP1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: APZ51514
UniProt: A0A1P8UQ33
LinkDB All DBs
Position
complement(508121..508936)
Genome map
AA seq 271 aa AA seqDB search
MRDEGFQVTEVDAGPDLAQVLTALAPDVVFNALHGRWGEDGCVQGLLEWLGIPYTHSGVL
SSALAMDKERTKQVYRAAGLPVVDSLLADKSEIEARHVLAPPYVVKPYNEGSSVGVYLVQ
DGANSPPRLAAEMPETLMVEAYVPGRELTTTVMGDRALTVTDILTDGWYDYDAKYKEGGS
RHVLPAEVPQEIFDACLDYALRAHEALGCRGTSRTDFRWDESRGLAGLVLLETNTQPGMT
PTSLVPEQAQYLGYSFGQFCRWLVEDASCNR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgagggatgaaggattccaggtcaccgaggtcgatgccggccccgatctggcgcaggtg
ctgacagcgctcgcgcccgatgtcgtgttcaacgcgctgcatggccgttggggcgaagac
ggctgcgtgcaggggctgctggaatggttggggattccctatacccattccggcgttctg
tcctcggcgctggccatggacaaggaacgcaccaagcaggtctatcgcgccgccgggctg
ccggtggtggacagcctgcttgccgacaaatccgagatcgaagcgcgccacgttctggcg
ccgccctatgtggtgaagccctataacgagggctcttcggtcggtgtctatctggtgcag
gacggggccaattcgccgccgcgcctggccgccgagatgcccgagacgctgatggtcgag
gcctatgtgcccgggcgcgagcttaccaccacagtgatgggcgaccgggcgctgacggtg
accgatattctcaccgatggctggtacgattacgacgccaagtacaaggagggcggctcg
cgccatgtgctgcccgccgaggtgccgcaggagatctttgacgcctgtctcgattacgcg
ctgcgcgcccatgaggcgctgggctgccggggcaccagccgcacggatttccgctgggac
gagagtcgcggtcttgccgggctggtgctgctcgagaccaacacccagccgggcatgacg
ccgacctcgctggtgcccgagcaggcgcaatatcttggttacagcttcgggcagttttgc
cgctggctggtggaggatgcctcttgcaaccgatga

DBGET integrated database retrieval system