KEGG   Pelagibaca abyssi: Ga0080574_TMP1292Help
Entry
Ga0080574_TMP1292 CDS       T04681                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
paby  Pelagibaca abyssi
Pathway
paby00790  Folate biosynthesis
paby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paby00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ga0080574_TMP1292
Enzymes [BR:paby01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Ga0080574_TMP1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: APZ51626
UniProt: A0A1P8UQE7
LinkDB All DBs
Position
627443..628453
Genome map
AA seq 336 aa AA seqDB search
MRDYYRPLVRSDDPRPDDALPLAGGPRWFSHVIRHRRDGSLARLAAAALPDDVRTRLSAP
RPSLLGLPMDRPQIMGILNVTPDSFSDGGSDRSAAEAALRGRRMMSEGADLLDIGGESTR
PGAQEVAVGEEIGRTEPVIRALAGVPISIDTRKTRVARAGIRAGAALVNDVSGLTFDPEL
AGFCVDHGIPVCIMHSLGGPETMQDDPRYDDVLLDVYDFLEAQIAMIEALGLSRDKIVVD
PGIGFGKTQAHNLALLNGLALFHGLGCPILLGASRKGFIGRLGEAPDPKDRAPGSIAVAL
AGISQGAQIVRVHDVAATRQALALWQAVEQGGRDDA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgactactaccgccccctcgtccgctcggacgatccccgcccggacgacgccctg
ccgctcgccggcggcccccgctggttctctcatgtcatccgccaccggcgcgacggcagc
ctcgcgcggctcgccgccgccgcgttgcccgacgatgtgcgcacccggctgagcgccccg
cgcccgtcgctgctgggtctgccgatggaccgcccgcagatcatgggcatcctcaatgtg
acgcccgacagtttctccgacggcggctccgaccgctccgccgccgaggccgcgctgcgc
gggcgccggatgatgagcgagggcgccgacctgctggatatcggtggcgaaagcacccgg
cccggcgcgcaggaggtggccgtgggcgaggagatcgggcgcaccgagccggtgatccgc
gccctggccggcgtgccgatctccatcgacacgcgcaagacccgggtggcgcgcgccggc
atccgcgcgggcgcggcgctggtcaacgatgtctcggggctgaccttcgacccggagctc
gccggtttctgtgtcgaccatggcatcccggtctgcatcatgcattcgctgggcggcccg
gagaccatgcaggacgacccgcgctatgacgacgtgctgctggatgtctacgatttcctg
gaggcgcagatcgccatgatcgaggcgctggggctcagccgcgacaagatcgtggtcgat
ccgggcatcggcttcggcaagacccaggcgcacaatctggctctgctgaacgggctggca
ctgttccacgggctggggtgtccgatcctgctcggcgcctcgcgcaagggcttcatcggg
cggctcggcgaggcccccgatccgaaagaccgcgcgcccggctccatcgccgtggcgctg
gcgggaatatcccagggcgcgcagatcgtccgggttcacgatgtggccgcgacacgccag
gcgctggcgctctggcaggcggtcgagcagggaggccgggatgacgcgtaa

DBGET integrated database retrieval system