KEGG   Pelagibaca abyssi: Ga0080574_TMP197Help
Entry
Ga0080574_TMP197  CDS       T04681                                 

Definition
(GenBank) D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
paby  Pelagibaca abyssi
Pathway
paby00040  Pentose and glucuronate interconversions
paby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ga0080574_TMP197
Enzymes [BR:paby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Ga0080574_TMP197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: APZ50531
UniProt: A0A1P8UMA5
LinkDB All DBs
Position
pPABY2:complement(71136..72173)
Genome map
AA seq 345 aa AA seqDB search
MKALVLEEKGRLALREFDSPGTLGPRDVRIKTHTVGICGSDVHYYTHGKIGHFVVTEPMV
LGHEASGTVIECGSEVSGLKPGDRVCMEPGIPDPDSRASKLGIYNVDPAVRFWATPPVHG
CLTPEVIHPAAFTYKLPESVSFAEGAMVEPFAIGMQAALRARIQPGDIAVVTGAGPIGMM
VALAALAGGCARVIVADLAQPKLDIIGAYDGIETVNIRETPVAEAVAAATDGWGADVVFE
CSGAAPAILGMHELARPGGAIVLVGMPVDPVPVDIVGLQAKELRVETVFRYANVYDRAIA
LMASGKVDLTPLISGTVPFEESIAGFDRAVEARDTDVKLQIAMPE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctggttctggaggaaaagggcaggctcgccctgcgggagttcgacagtccc
ggcacgctcgggccgcgcgacgtgcggatcaagacccatacggtcggtatctgcggctcg
gatgtgcattattacacccatggcaagatcggccatttcgtggtgaccgagccgatggtg
ctggggcacgaggcctcgggcacggtgatcgaatgcggcagcgaggtgagcgggctgaaa
cccggcgaccgggtctgcatggagcccggcattcccgacccggacagccgcgccagcaag
ctggggatctacaatgtcgatccggcggtgcgcttctgggcgacgccgccggtgcatggc
tgcctgacccccgaggtgatccaccccgccgcctttacctacaagctgcccgagagcgtc
agctttgccgagggcgccatggtcgagcctttcgccatcggcatgcaggcggcgctgcgg
gcgcgcatccagccgggcgatatcgcggtggtcaccggcgccggcccgatcggcatgatg
gtggcgctggcggccctcgcgggcggctgcgccagggtgatcgtcgccgatctcgcccag
cccaagctcgacatcatcggcgcctatgacggcatcgagacggtgaatatccgcgagacg
ccggtggccgaggcggtggcggcggccaccgatggctggggcgcagatgtggtctttgaa
tgctccggcgcagcgccggccattctcggcatgcatgaactggcccggcccggcggcgcg
atcgtgctggtgggcatgccggtcgatccggtgccggtggatatcgtcgggctccaggcc
aaggagctgcgggtcgagacggtgttccgctacgccaatgtctatgaccgggcgattgcg
ctcatggcctcgggcaaggtggatctgacaccgctgatctcgggcaccgtgccgttcgaa
gagagcatcgctggtttcgaccgcgcggtcgaggcgcgcgacaccgatgtgaagctccag
atcgcgatgccggagtga

DBGET integrated database retrieval system