KEGG   Pelagibaca abyssi: Ga0080574_TMP2981Help
Entry
Ga0080574_TMP2981 CDS       T04681                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
paby  Pelagibaca abyssi
Pathway
paby00240  Pyrimidine metabolism
paby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paby00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ga0080574_TMP2981
Enzymes [BR:paby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Ga0080574_TMP2981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: APZ53315
UniProt: A0A1P8UV95
LinkDB All DBs
Position
2396442..2397137
Genome map
AA seq 231 aa AA seqDB search
MRCEAGEVARAGYLLPASQAAPACVSAPPAAWNGAMAKLYFHYSTMNAGKSTLLLQAAHN
YGERGMEVYLLTARLDTRAGEGRIGSRIGLGREADTFTAEDDLFARIEAQASGRNLACIF
VDEAQFLTEPQVWQLARVADDLNIPVMAYGLRVDFRGQLFPGSAVLLALADTLREVRTIC
HCGRKATMVIRQDAQGRAVMDGDQVQIGGNETYVSLCRRHWREAMGERAPE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgcgaggccggcgaggtggcccgagcaggatatcttttgcccgcttcgcaggcc
gcgccggcttgcgtgtccgcgccgcctgcggcatggaacggcgccatggccaagctctat
tttcactactcgacaatgaatgcgggcaagtcgacgctgctcttgcaggcggctcataac
tatggcgagcgcggaatggaggtctatctgctgaccgcgcggctcgacacgcgggccggc
gaaggccggatcggctcacgcatcggactggggcgcgaggcggataccttcacggcggag
gacgatctctttgcccggatcgaggcgcaggcctcgggtcggaatctcgcctgcatcttt
gtcgatgaggcgcagttcctgaccgagcctcaggtctggcagctggcgcgcgtggccgac
gatctgaacattccggtcatggcctacgggctgcgtgtggattttcgcgggcagcttttc
cccggctcggcggtgttgctggcgctggccgatacgctgcgcgaggtgcgcacgatctgc
cattgcgggcgcaaggcgacgatggtgatccgccaggacgcgcagggccgggcggtgatg
gatggcgatcaggtgcagatcggcggcaacgagacctatgtctcgctctgccgccggcac
tggcgcgaggcgatgggcgagcgggcgccggaatag

DBGET integrated database retrieval system