KEGG   Pelagibaca abyssi: Ga0080574_TMP3476Help
Entry
Ga0080574_TMP3476 CDS       T04681                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
paby  Pelagibaca abyssi
Pathway
paby00630  Glyoxylate and dicarboxylate metabolism
paby01100  Metabolic pathways
paby01120  Microbial metabolism in diverse environments
paby01200  Carbon metabolism
Module
paby_M00165  Reductive pentose phosphate cycle (Calvin cycle)
paby_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:paby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ga0080574_TMP3476
Enzymes [BR:paby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Ga0080574_TMP3476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: APZ53810
UniProt: A0A1P8UWR8
LinkDB All DBs
Position
complement(2874931..2875350)
Genome map
AA seq 139 aa AA seqDB search
MRLKQGQFSFLPDLTDDDIRTQAQYAIDNGWAVSVEYTDDPHPRNSYWEMWGHPMFDNPD
AAAVVYEVNECRKEHGGKYIRVLAFDATAGWESIRMSFIVNRPAEEPGFRVVRQEGEGRS
IRYTVESYAVREPEGARYA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgaaacaaggtcaattcagcttcctgcccgatctcaccgacgacgacatccgc
acgcaggcgcaatacgccatcgacaacggctgggcggtctcggtggaatataccgacgat
ccgcacccgcggaattcctactgggagatgtggggccacccgatgttcgacaatccggac
gcggcggcggtggtctatgaggtcaacgaatgccgcaaggagcatggcgggaaatatatc
cgcgtgctggccttcgacgcgaccgcgggctgggaatcgatccgcatgagcttcatcgtg
aaccgtcccgccgaggagcccggcttccgcgtggtgcggcaggaaggcgagggccgcagc
atccgctacacggtggaaagctacgcggtgcgcgaacccgagggggcgcgctacgcctga

DBGET integrated database retrieval system