KEGG   Pelagibaca abyssi: Ga0080574_TMP3477Help
Entry
Ga0080574_TMP3477 CDS       T04681                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
paby  Pelagibaca abyssi
Pathway
paby00630  Glyoxylate and dicarboxylate metabolism
paby01100  Metabolic pathways
paby01120  Microbial metabolism in diverse environments
paby01200  Carbon metabolism
Module
paby_M00165  Reductive pentose phosphate cycle (Calvin cycle)
paby_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:paby00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ga0080574_TMP3477
Enzymes [BR:paby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Ga0080574_TMP3477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: APZ53811
UniProt: A0A1P8UWP3
LinkDB All DBs
Position
complement(2875431..2876894)
Genome map
AA seq 487 aa AA seqDB search
MLDNAKTVTDAKKRYSAGVMKYAQMGYWEPDYTPKETDIIALFRITPQDGVDAVEAAAAV
AGESSTATWTVVWTDRLTACDKYRAKAYRVDPVPNSEGEFFAYIAYDLDLFEGGSIANLT
ASIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERERLNAYGRPLLGATVKPK
LGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYCMEAVNRASAATGEVKG
TYLNVTAATMEEMYERAEFAKSLGSVVIMIDLVIGYTAIQSMAKWARDNDMILHLHRAGH
STYTRQRSHGVSFRVIAKWMRLAGVDHLHAGTVVGKLEGDPATTKGYYDIFREEYNPMAL
ENGIFFDQDWASLNKMMPVASGGIHAGQMHQLLTYLGEDVVLQFGGGTIGHPHGIQAGAT
ANRVALEAMVFARNAGRDIWNEGEDILRDAARTCTPLKQALDTWKDVTFDYASTDAPDFA
PTPEVSA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctggacaacgccaagaccgtcaccgacgccaagaagcgctatagcgcgggcgtgatg
aaatatgcccagatgggctattgggagccggattacacgcccaaggaaaccgacatcatc
gcgctgttccgcatcaccccgcaggacggtgtggacgcggtcgaggccgccgccgccgtg
gcgggcgaaagctccaccgccacctggaccgtggtctggaccgaccggctcaccgcctgc
gacaagtaccgcgccaaggcctacagggtggacccggtgcccaacagcgagggcgagttc
tttgcctatatcgcctatgatctcgatctcttcgaaggcggctccatcgccaacctgacc
gcctcgatcatcggcaatgtctttggcttcaagccgctgaaggctctgcggctcgaggac
atgcgcctgcccgtggcctatgtgaagacctttcaggggcccgccaccggcatcgtggtg
gagcgcgaacggctcaacgcctatggccgcccgctgctgggtgccacggtgaagcccaag
ctcgggctttcggggcgcaattatggccgggtggtctatgaggcgctgaagggcgggctc
gatttcaccaaggatgacgagaacatcaacagccagcccttcatgcactggcgcgaccgg
tttctctattgcatggaggcagtcaaccgcgcctccgccgccaccggcgaggtgaagggc
acctatctcaacgtcaccgccgcgacgatggaagagatgtacgagcgggcggaattcgcc
aagtcgctgggctcggtcgtcatcatgatcgacctggtgatcggctacaccgcgatccag
tccatggcgaaatgggcgcgggacaatgacatgatcctgcacctgcaccgcgcgggccat
tcgacctatacccgccagcgctcgcacggggtgtcgttccgcgtcatcgccaaatggatg
cggcttgccggggtcgatcacctgcatgcgggcaccgtggtgggcaagctcgagggtgat
ccggccaccaccaagggctactacgatatcttccgcgaggaatataatccgatggcgctg
gagaacggcatcttcttcgatcaggactgggcctcgctcaacaagatgatgccggtcgcc
tcgggcggcatccacgccggccagatgcaccagctgctgacctatctgggcgaggatgtg
gtgctgcaattcggcggcggcacgatcggccacccgcatggcatccaggcgggcgccacg
gcgaaccgcgtggcgctggaggcgatggtctttgcccgcaatgccgggcgcgacatctgg
aacgagggcgaggacatcctgcgcgacgcggcccgcacctgcacgccactgaaacaggcg
ctcgacacctggaaggacgtcaccttcgattacgcctcgaccgacgcgcccgatttcgcg
ccgacccccgaggtttccgcctga

DBGET integrated database retrieval system