KEGG   Pelagibaca abyssi: Ga0080574_TMP3549Help
Entry
Ga0080574_TMP3549 CDS       T04681                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
paby  Pelagibaca abyssi
Pathway
paby00970  Aminoacyl-tRNA biosynthesis
paby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paby00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ga0080574_TMP3549
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:paby03029]
    Ga0080574_TMP3549
Enzymes [BR:paby01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Ga0080574_TMP3549
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Ga0080574_TMP3549
Mitochondrial biogenesis [BR:paby03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ga0080574_TMP3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: APZ53883
UniProt: A0A1P8UWW7
LinkDB All DBs
Position
2950348..2951862
Genome map
AA seq 504 aa AA seqDB search
MLDLSFETPKPKVIAGAKYDWELVIGMEVHAQVASEAKLFSGASTKFGAEPNSNVSFVDA
AMPGMLPVINEFCVEQAVRTGLGLKAEINLKSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVIVDMEPGIARLVRIERIHIEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIRG
PEEAAAYVSKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRC
EIKNMNSMRFIQAAIDYEARRQIAILEAGGSVDQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQAWVDDIAANLPELPDAKKARFVGDFGLSEYDAGVLTAEVANAAYFEE
VAGEAGDGKLAANWVINELFGRLKKEDHAIEDSPVSPAQLAGIIRLIKSDAISGKIAKDL
FEIVYTEGGDPEKIVEERGMKQVTDTGAIETAVDEIIAANPAQVEKAKQNPKLAGWFVGQ
VMKATGGKANPKAVNEIVSKKLAQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacctgagcttcgagacccccaaacccaaggtcatcgccggggccaaatacgat
tgggaactggtgatcggcatggaggtgcatgcccaggtcgcctccgaggccaagctgttc
tcgggggcctcgaccaaattcggcgccgagccgaacagcaatgtcagcttcgtggacgcg
gccatgcccggcatgctgccggtcatcaacgaattctgcgtcgagcaggcggtgcgcacc
gggctggggctgaaggcagagatcaacctgaaatccgccttcgaccgcaagaactatttc
taccccgatctgccgcagggctatcagatctcgcagctttatcacccgattgtcggcgag
ggcgaggtgatcgtggatatggagccgggcatcgcccgcctcgtgcgcatcgagcggatc
catatcgagcaggatgccggcaagtcgatccacgacatggatccgaacatgtccttcgtc
gatctcaaccgcaccggcgtggcgctgatggagatcgtctcgcgccccgacattcgcggg
cccgaagaggccgccgcctatgtgtcgaagctgcgccagatcctgcgttatctcggcacc
tgcgacggcaatatgcagaacggcaacctgcgggccgacgtgaacgtttcggtctgccgc
cccggccagtacgagaaatatcaggaaacgcaggatttcagccatctcggcacgcgctgc
gagatcaagaacatgaactccatgcgctttatccaggccgccatcgattacgaggcgcgc
cgccagatcgccattctggaggccggcggctcggtcgatcaggaaacccggctctacgat
ccggacaagggcgagacgcggtcgatgcgctccaaggaagaggcgcatgattaccgctac
ttccccgatcccgacctgctgccgctggagatcgaacaggcctgggtggacgatatcgcc
gccaacctgcccgagctgccggatgccaagaaggcgcggttcgtgggcgatttcggcctg
tcggaatacgatgccggcgtgctgaccgccgaggtggcgaatgccgcctatttcgaagag
gtcgcgggcgaggcgggcgacggcaagcttgccgccaactgggtgatcaacgagctcttc
ggtcgcctcaagaaggaggaccatgccatcgaggacagcccggtctcgccggcgcagctt
gcgggcataatccggttgatcaagtcggacgcgatttccggcaagatcgccaaggatctg
ttcgagatcgtctataccgagggcggcgacccggaaaagatcgtcgaagagcgcggcatg
aagcaggtgaccgataccggtgccatcgaaaccgccgtcgacgagatcatcgccgccaac
ccggcgcaggtggaaaaggccaagcagaaccccaagctcgcgggctggttcgtcggtcag
gtgatgaaggccaccggcggcaaggccaacccgaaggcggtgaacgagatcgtctcgaaa
aagctcgcgcagtaa

DBGET integrated database retrieval system