KEGG   Pelagibaca abyssi: Ga0080574_TMP4326Help
Entry
Ga0080574_TMP4326 CDS       T04681                                 

Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
paby  Pelagibaca abyssi
Pathway
paby00061  Fatty acid biosynthesis
paby00780  Biotin metabolism
paby01100  Metabolic pathways
paby01130  Biosynthesis of antibiotics
paby01212  Fatty acid metabolism
Module
paby_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:paby00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Ga0080574_TMP4326
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Ga0080574_TMP4326
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Ga0080574_TMP4326
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paby01004]
    Ga0080574_TMP4326
Enzymes [BR:paby01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Ga0080574_TMP4326
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Ga0080574_TMP4326
Lipid biosynthesis proteins [BR:paby01004]
 Fatty acid synthase
  Component type
   Ga0080574_TMP4326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: APZ54660
UniProt: A0A1P8UZ47
LinkDB All DBs
Position
complement(3739372..3740178)
Genome map
AA seq 268 aa AA seqDB search
MSNTLMAGKRGLIMGLANDKSIAWGIAKALHGAGAELAFSYQGDALKKRVEPLAAQLDSD
LVLPCDVGSEESIDELFNTLKEKWDGLDFIVHAIGFSDKSELRGRYVDTTRGNFITTMDI
SVYSFTAVMRRAEKMMSPGSAALTLTYYGAERIMPHYNVMGVAKAALEASVRYLAEDLGK
DGIRVNAISAGPIKTLAASGIGDFRYIMKWNEYNSPLRRNVTIEDVGGSALYLLSDLGGG
VTGETHHVDAGYHVVGMKAVDAPDITKG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacactctgatggcgggcaagcgcggcctgatcatgggactcgccaacgacaag
tcgattgcctggggcatcgcaaaagcgttgcatggtgcaggcgccgagcttgccttttcc
tatcagggggacgccctgaagaaacgcgtcgagccgttggcggcgcagctggactccgat
ctggtgctgccctgcgatgtcggcagcgaagagtccatcgacgaattgttcaatacgctc
aaggagaaatgggacggactggacttcatcgtccacgccatcggcttctctgacaagagc
gaactgcgcggtcgctatgtcgacacgacgcgcggcaatttcatcacgaccatggatatc
tcggtctattccttcaccgcggtgatgcggcgggcggagaagatgatgagcccgggcagc
gcggcgctgaccctcacctattacggtgccgagcggatcatgccacactataatgtgatg
ggcgtggccaaggcggcgctggaagcttcggtgcgctatctcgccgaggatctgggcaag
gacggcattcgcgtcaatgcgatctccgccggcccgatcaagacgctggccgcctccggc
atcggcgatttccgctacatcatgaagtggaacgagtacaactcgccgctgcgccgcaat
gtgaccatcgaagatgtcggcggctcggcgctttacctgctgtcggatctgggcggcggt
gtcaccggtgagacccaccatgtggatgcgggctatcacgtcgtcggcatgaaggccgtc
gacgcgcccgacatcaccaagggctga

DBGET integrated database retrieval system