KEGG   Pelagibaca abyssi: Ga0080574_TMP4994Help
Entry
Ga0080574_TMP4994 CDS       T04681                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
paby  Pelagibaca abyssi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APZ55276
UniProt: A0A1P8V0Y9
LinkDB All DBs
Position
pPABY4:62044..63531
Genome map
AA seq 495 aa AA seqDB search
MTIQDVIRHPGKFYIGGAWTDPSSGDEITVLNSATEEVFEVVAEAQEADVNRAVDAARQA
FDKGPWPRMSHEERAGYLRALADELDKRAERHARIWVTESGVLHSIAATRMGSIAATYRY
YADLASTFPFQEKHPSASGGELALLVREPVGVVGAIVPWNGTPGLITSKVAPALLAGCCV
VVKASPEAPGSAYILAEAAEAAGLPEGVVNILTADREVSEKLVAHPGVDKIAFTGSTIAG
QKIGAICGGRIARQTLELGGKSPALILDDYDIETAAKAITEKATFLTGQVCASLTRIVVS
KARHDDMVEALSSQFAKVNVGDPFEAACQMGPLAMSRQRDRVEGYIAKGREEGAKLAAGG
GRPAHLNRGYFVEPTVFGNVQNSFTIAREEIFGPVLSVIPAEDESAMIDIANDTDFGLNA
SVFTNDDDRAYVVAREIRSGTVGQNSYRAELGLAFGGFKQSGLGREGGTEGLHPYLETKV
IVLDGMPSNVGRIAG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcaagacgtgatccggcatcccggaaaattctatatcggcggcgcctggacc
gacccgtcgagcggtgacgagatcaccgttctgaactccgccaccgaagaggtgttcgag
gtggtggccgaggcgcaggaggcggatgtgaaccgcgccgtggatgccgcccggcaggcc
tttgacaagggcccgtggccgcgcatgagccatgaggagcgcgccggctatctgcgcgcg
ctggccgatgaactcgacaaacgggcggagcggcatgcgcggatctgggtgaccgagtcc
ggcgtgctgcattccatcgcggcgacgcgcatgggctcaatcgccgcgacctaccgttat
tacgccgatctggcttccaccttcccgtttcaggaaaagcacccctcggcctcgggtggc
gagctggcgctcctggtgcgcgagccggtgggggtggtgggcgccatcgtgccgtggaac
ggcacgccggggctgatcacctccaaggtggcgccggcgctgctggcgggctgttgcgtg
gtggtcaaggcctcgcccgaggcgccgggctcggcctatatcctcgccgaagccgcagaa
gccgcggggctgcccgagggggtggtcaatattctgaccgccgaccgtgaggtctcggaa
aagctggtggcgcatccgggcgtggacaagatcgcctttaccggctcgaccatcgccggg
cagaagatcggcgcgatctgcggcgggcgcatcgcgcgccagacgctggagctgggcggt
aagtcgccggcgctgatcctcgacgactacgatatcgagacggcggccaaggcgatcacc
gaaaaggccaccttcctcaccgggcaggtctgcgcctcgctgacccgcatcgtggtgtcg
aaagcccgccatgacgacatggtggaggcgctgagcagccagttcgccaaggtcaatgtg
ggcgatccgttcgaggccgcctgccagatggggccgctcgccatgagccggcagcgcgac
cgggtggagggctatatcgccaagggccgcgaggagggcgcaaagcttgccgccggcggc
gggcgcccggcacatctcaaccggggctatttcgtcgagcccacggtcttcggcaatgtg
cagaacagtttcaccatcgcgcgcgaggagatctttggcccggtgctctcggtgatcccg
gcggaggatgaaagcgcgatgatcgacatcgccaacgacaccgatttcgggctgaacgcc
tcggtctttaccaatgatgacgaccgcgcctatgtggtcgcgcgcgagatccgttccggc
acggtggggcagaacagctatcgcgccgagctcgggctggcctttggcgggttcaagcag
tcggggctgggtcgcgagggcggcaccgaggggctgcacccctatctcgaaaccaaagtg
attgtcctggatggcatgccgtcgaacgtgggtcgcatcgccggctga

DBGET integrated database retrieval system