KEGG   Cutibacterium acnes KPA171202: PPA1437Help
Entry
PPA1437           CDS       T00188                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00020  Citrate cycle (TCA cycle)
pac00190  Oxidative phosphorylation
pac00650  Butanoate metabolism
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01120  Microbial metabolism in diverse environments
pac01130  Biosynthesis of antibiotics
pac01200  Carbon metabolism
Module
pac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPA1437
   00650 Butanoate metabolism
    PPA1437
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PPA1437
Enzymes [BR:pac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PPA1437
    1.3.5.4  fumarate reductase (quinol)
     PPA1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_7 Fer4_10 Fer4_9 Fer4_18 Fer4 Fer4_6 Fer4_2 Fer4_15 Fer4_4 Fer4_16 Fer4_3 Fer4_21 Fer2 Fer4_13 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AAT83185
UniProt: Q6A7T0
LinkDB All DBs
Position
complement(1553582..1554355)
Genome map
AA seq 257 aa AA seqDB search
MKINLRIWRQRNSKDQGRLVEYTLDGVSGDMSFLEMLDMLNENLTAQGEEPVAFDSDCRE
GICGQCGVVINGVPHGGMGAAQPVRTTTCQLHMRSFADGSTITIEPWKSGAFPILRDLIV
DRSALDRVIQAGGYVSVNTGAAPDAHAVQVNKKRSDRSFDAATCIGCGACVAACPNGSSM
LFTSAKITHLAMLPQGQPERMRRVKAMAAQNDAEGFGGCTNIGECASVCPKGIPLESISQ
LNRDLIASLFKHDGKDD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcaacctgcgaatctggcgtcagcgcaattccaaggatcagggccgcctcgtc
gagtacaccctggacggtgtttccggtgatatgtccttccttgagatgttggacatgctc
aacgagaacctcaccgctcagggtgaagagcccgtcgcatttgactcggactgccgcgag
ggtatttgcggtcagtgcggcgtcgtcatcaatggtgtgccgcacggtggtatgggtgct
gcccagccggtgcgtaccactacgtgtcagctgcacatgcgctccttcgccgatggctcg
accatcacgatcgagccatggaagtcgggtgccttcccgattctgcgtgaccttatcgtg
gatcgctcggcccttgaccgtgtcatccaggctggcggctatgtctcggtgaacaccggt
gctgccccggacgctcacgctgttcaggtcaacaagaagcgctctgaccgctccttcgac
gccgctacctgcatcggttgtggcgcctgcgtggcggcctgcccgaacggctcctcgatg
ctgtttacttctgcgaagatcactcacctggccatgcttccgcagggtcagccggagcgg
atgcgtcgtgttaaggctatggctgcgcagaacgacgctgaaggattcggtggctgcacc
aacattggtgagtgcgcctcggtgtgcccgaaaggtattccgctggagtccatcagccag
ctcaaccgcgacctcattgcgtcgctgttcaagcacgacggcaaggacgactga

DBGET integrated database retrieval system