KEGG   Cutibacterium acnes KPA171202: PPA1990Help
Entry
PPA1990           CDS       T00188                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pac  Cutibacterium acnes KPA171202
Brite
KEGG Orthology (KO) [BR:pac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PPA1990
Enzymes [BR:pac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PPA1990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Thi4 FAD_oxidored NAD_binding_8 DAO FAD_binding_3 Glutaredoxin AlaDh_PNT_C FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AAT83706
UniProt: Q6A6A7
LinkDB All DBs
Position
2160996..2162702
Genome map
AA seq 568 aa AA seqDB search
MRPSPRRSTSSARSEFRPEHLLQGRSSLRRIPGPVPFPPPFRRTMLDNALTTQLKTYLEM
VREPIVLVPSPYRGDDAAKSSKSAHMDELLSEIAALSDKVSVGKPVDNERTPSFAITRPG
SPIDIRFAGLPMGHEFTSLVLALLQVGGHPVKEEQSLIDAVRAVKGEHHFVTYMSLTCQN
CPTVVQALNAMAVLNPNIHHTAVDGGTHTDEVEAKGIASVPAIYLDGEDWGSGRMDMAEI
LERLDADAAQGAKEDLSQRDPYDVLVVGAGPAGAAAAVYAARKGIRTAMVGSRIGGQVLD
TEAIDNLISVPHTTGPRLADALRSHVNDYNIDVIERQTASAIETTGGMTTVHLTDGDLRA
RSVIVATGARWRNLGVPGEKEYRTKGVTYCPHCDGPLFTGKKVAVVGGGNSGIEAAIDIA
GVVDHVTVVEFLDALKADDVLLRTLNSLPNVDVITSARTTQILGDGSKVTGLEYEDRTSG
DVKTIELAGVFVQIGLLPNTEWLEGALERNQRGEIVIDERGTTSAPGIFAAGDCTTQPYK
QIIISMGAGATAALGAFDHLIRQNPTQN
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgagaccctcgccccgtcgatcgacctcgtcggcaagatctgagttccgacccgagcat
ctgctgcaggggcgctcgtccctgcggcggatccccggaccggtacccttccctcccccc
ttcaggagaaccatgcttgataatgccctgaccactcagctcaagacctacctcgagatg
gtgcgcgagccgatcgtcctggtgccttccccataccggggtgacgacgccgcaaaatcg
tcaaagtcggctcacatggacgagcttttatccgagatcgccgccttgtctgacaaagtg
agcgtcggtaagcccgtcgacaatgagcgcaccccctcctttgccatcacccgccccgga
agccccatcgacatccgctttgcgggcctgccgatgggccacgaattcacctccctcgta
ctggccctgctgcaggtaggtggacaccccgtcaaggaggagcagtccctcatcgacgcc
gtgcgcgcggtcaagggtgagcaccacttcgtcacctacatgtcactaacctgccaaaat
tgcccgacggtagtgcaggccctcaacgcaatggccgtcctcaacccgaatattcaccac
accgccgttgacggtggcacccacaccgatgaggtagaagccaaaggaatcgcctcggtg
ccggccatctacctggacggcgaggactggggctccgggcgcatggacatggccgaaatc
ctcgagcgtctcgacgccgacgccgcccagggagccaaggaagacctctcgcagcgcgac
ccctacgacgtgctcgtcgtaggggcgggtcccgccggtgccgcggccgccgtgtacgcg
gctcgtaagggcattcgcaccgccatggtcgggtctcgaatcggcggccaggtactcgat
accgaggccatcgacaacctcatctcggtgccgcacaccaccggtccgcgtctggccgac
gccctccgcagccacgtcaacgactacaacattgacgttattgagcgtcagaccgccagc
gccatagagaccaccggcggtatgaccaccgtgcatctgaccgacggcgacctgcgggcg
cgctcagtcatcgtggccaccggtgcccgctggcgcaaccttggcgtgcctggcgagaag
gaataccgcaccaagggtgtgacctactgcccgcactgcgatggcccgctattcacaggc
aaaaaggtggccgtcgtcggaggtggaaactccggcattgaggccgctatcgacattgcc
ggcgtcgtcgaccacgtcaccgtcgtggagttcctcgacgccctcaaggctgacgacgta
ctactacgcaccctgaactcactgccgaacgtcgacgtcatcacctcggcccgcaccacc
cagatcctcggcgacggatccaaggtgaccggtctggaatacgaggaccgcaccagcggc
gacgttaagaccatcgagctagcaggtgtgtttgtccaaatcggtctgctgcccaacacc
gaatggctcgaaggtgccctggagcgcaaccagcggggagaaatcgtcatcgacgagcgt
ggcaccacctcagcccccggaatcttcgccgccggtgactgcaccactcagccgtacaag
cagatcatcatctcgatgggggccggcgccaccgctgctctaggcgccttcgaccacctc
atccgtcaaaatccgacacagaactga

DBGET integrated database retrieval system