KEGG   Candidatus Paracaedibacter acanthamoebae: ID47_03740Help
Entry
ID47_03740        CDS       T03232                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
paca  Candidatus Paracaedibacter acanthamoebae
Pathway
paca00970  Aminoacyl-tRNA biosynthesis
paca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ID47_03740 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:paca03029]
    ID47_03740 (gatB)
Enzymes [BR:paca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ID47_03740 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ID47_03740 (gatB)
Mitochondrial biogenesis [BR:paca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ID47_03740 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF126
Motif
Other DBs
NCBI-ProteinID: AIK96045
UniProt: A0A077AZ73
LinkDB All DBs
Position
773400..774881
Genome map
AA seq 493 aa AA seqDB search
MSENKNLIQGRTGLWEVVIGLEVHAQVNSKAKLFDGCSTDFGADPNTQVGFFTAAMPGML
PVINHLCVDQAIKTGLGLNAVINKFSVFDRKNYFYADLPCGYQISQFTRPIVSGGYLDID
LEDGESKRINITRLHLEMDAGKSIHDLHPTKTYIDLNRSGIALMEIVSEPEMRSSAQAMA
YVKKLRSILRYMGTCDGNMEQGSMRVDANISLRRPGQPFGTRAEIKNVNSIRFLGQAIEF
EIARQLDILEDGGEIVQETRLFDPGKGETRSMRSKEDAHDYRYFPDPDLLPLRLTDERIN
AIHATMPELPDAKRQRLMAEFGLPLYDATVIVSERETADYYERAVAALTAKDKVQGAKQI
ANWLMGDVFAAMNRDNKTVETMPLEAKNLAGMIDLILDNTISGKIAKDVFLKMWESGKAP
AALVEELGLKQITDASVIEQAVDEILTQHADKVADYKAGKETLFGFFVGQVMKATQGKAN
PGMVNDLIKKKLS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaataaaaacctcattcaagggcgcacagggctatgggaagttgtcatcggt
cttgaagtccacgctcaagtaaactctaaggcgaaactttttgatggatgctccacggat
tttggggcggaccctaatactcaagttggtttctttacagcggcgatgccgggaatgctg
ccggttatcaatcatctttgcgtggatcaagcaattaaaactggacttggattaaatgcc
gttattaataagttttcagtttttgatcgtaaaaattatttctatgctgacttaccgtgc
ggttatcagatttcccaatttacacgtcccattgtcagtggcgggtatttggatatcgat
ttagaggatggtgaatctaaacgcatcaatattactcgattgcacttagagatggatgcc
ggtaaaagcattcacgacttgcatcctacaaaaacctatattgacttaaaccgcagcggt
attgccctgatggaaatcgtgtcagaaccagaaatgcgatctagcgctcaagccatggcc
tatgtaaaaaagctgcgctctattttacgctatatgggaacttgtgatgggaatatggaa
caaggcagcatgcgggttgacgctaatatttccttacgccgtcccggccaaccctttggc
acccgagccgaaattaagaacgtcaactcaattcggttcttaggccaagccatcgaattt
gaaattgcgcggcagctcgacatcctcgaagatggtggcgaaattgtgcaagaaacgcgt
ttatttgatcctggcaaaggagaaactcgatccatgcgcagtaaggaagacgcccatgat
tatcgttatttccccgatcctgatctgttgcccctgcgcttaacagatgaaagaatcaat
gcgattcatgccaccatgccagaactccccgatgctaaacgtcaacgcctcatggctgag
tttggcttaccactttatgatgcaactgtgattgtttctgaacgcgaaaccgcagattat
tatgaaagggctgtcgccgccctcactgctaaagataaagtgcaaggggccaaacaaatt
gctaattggttgatgggtgacgtttttgctgccatgaatcgagacaacaagacggtcgaa
acaatgccgttagaagctaaaaacctggcaggtatgattgacctaattcttgataatacc
atttcaggaaagattgctaaggacgttttccttaaaatgtgggaatctggcaaagctccc
gcagccctggtcgaagaactcggtctcaagcaaatcaccgatgcctcagtgattgaacaa
gctgttgatgaaattttgactcagcatgccgataaagttgctgattataaagctggaaaa
gaaactttatttggattctttgtcggtcaagtgatgaaagccacccaaggtaaagctaac
cctggcatggttaatgacctgattaaaaagaagctttcttaa

DBGET integrated database retrieval system