KEGG   Cutibacterium acnes C1: PAC1_08060Help
Entry
PAC1_08060        CDS       T02330                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pacc  Cutibacterium acnes C1
Pathway
pacc00061  Fatty acid biosynthesis
pacc00780  Biotin metabolism
pacc01100  Metabolic pathways
pacc01130  Biosynthesis of antibiotics
pacc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pacc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAC1_08060
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PAC1_08060
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PAC1_08060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pacc01004]
    PAC1_08060
Enzymes [BR:pacc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PAC1_08060
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PAC1_08060
Lipid biosynthesis proteins [BR:pacc01004]
 Fatty acid synthase
  Component type
   PAC1_08060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AFU41365
LinkDB All DBs
Position
complement(1668203..1668976)
Genome map
AA seq 257 aa AA seqDB search
MGLLEGRTVLVTGVTMHTSIAFKAAQIAQDEGARVIVSNLPRAVGVTRRAVRKLDPVPEV
LELDVTDADQLAALPQQLRDLGVEKLDGVVHAIAFANPKTALGGKFLETEWDDVSVAVHT
STYSYVSLMTALVDILAEHASVVGLTFDATVSWPFYDWMGVAKAGLESANRYLARYLGPK
GVRCNLVSAGPLDTMAKTAIPGADAFNDVWGERAPLGWDTKDTTPAAKGIVALLSDWFPA
TTGEIIHVDGGMGSTGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggacttcttgaaggacgtaccgtcctcgtcacaggcgtgacgatgcacacctctatc
gcttttaaggcggcccagattgcccaggatgagggcgcccgggttattgtttcgaacctg
ccgcgtgccgtcggcgtcacccgtcgagctgttcgcaaactcgatccggtgccggaggta
ctcgaactcgatgtcaccgacgccgaccagctggctgccctgcctcagcaactgcgcgac
ctcggagtggaaaagcttgatggtgtcgttcacgccatcgccttcgctaaccccaagacg
gccctggggggcaagtttctcgaaacggaatgggatgacgtctcggtcgctgtccacacc
tccacgtattcttatgtctccttgatgaccgcccttgtcgacatcctcgccgagcatgct
tcggtcgtcggtctgacctttgacgccaccgtctcctggcccttctacgactggatggga
gtggccaaggcgggactggaatcggccaatcgctacctggctcgatacctgggccccaaa
ggtgtgcgctgcaacctagtgtccgctggtccgctggacaccatggctaaaacagctatt
ccgggcgctgatgcctttaatgatgtgtggggggagcgtgccccgcttggctgggacacc
aaggacaccacgcccgcggccaagggaattgttgccctcttgtctgactggttcccagcc
actaccggcgagataatccacgtcgatggcggtatgggttcgaccggagcttga

DBGET integrated database retrieval system