KEGG   Cutibacterium acnes C1: PAC1_10375Help
Entry
PAC1_10375        CDS       T02330                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family protein
Organism
pacc  Cutibacterium acnes C1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_2 2-Hacid_dh_C Methyltransf_25 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFU41820
LinkDB All DBs
Position
complement(2183585..2184628)
Genome map
AA seq 347 aa AA seqDB search
MTETMLAERFHAADRSITLEDIPIPHPGPGEVLVKVAYCGICHSDLSLISGAFPAALPVV
TQGHEASGTIVELGAGVIGWKEGDRVIPSAGRPCLKCRKCRRGAFTDCLDLNLMAFAYDG
AWAEYHIAQASGMTKIPDNVPLDQAALLADAVSTPYAAVVRTGKVHMGNAVAVWGVGGVG
THLVQLAKLAGGVPVIAIDLNDAVLERAKRVGADHTLRSDDPELMQKIEDITHGRMIDVA
FDAVGIKPTLRACVDSLDVDGKAVSVGLSAQDIDAGPFLNFNLQRKQVLGHLGYKSQDIA
LLAEMLSYHRLDLTESISKVIPLKDVESGIAELESHQGNPIRILVKP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaccatgcttgctgaacgtttccacgccgcagatcggtctatcaccctcgaa
gatatcccgatcccgcacccgggacccggtgaggtgcttgtcaaggtcgcttactgcggt
atttgccattctgacctgagtctcattagcggtgcgttccctgcagctctgccagtagtg
actcagggccatgaggcatccggaaccatcgtcgagctcggtgcgggcgtcatcggttgg
aaggagggtgaccgcgtcatcccatccgccggtcgcccttgtctcaagtgtcgcaagtgc
cgccgcggtgccttcacggactgtctggatctgaacctcatggcttttgcctacgacggc
gcatgggctgagtaccacattgcgcaggcctccggtatgacgaagatccctgacaacgtc
ccactggaccaggccgctctgctcgcagacgccgtatctaccccgtatgctgccgtcgtg
cgtaccggcaaggtccacatgggcaatgccgtggccgtgtggggcgtcggcggtgtcgga
acccacctcgtccaactagccaagcttgccggcggcgtccccgtcattgctattgatctc
aatgacgctgtcctcgagcgcgctaagcgagtcggcgccgaccacactctgcgtagcgac
gaccccgagctcatgcagaaaatcgaggacatcactcatggccgcatgatcgacgttgcc
ttcgacgccgtcggcatcaagccgacgctgcgtgcctgcgtcgactccctcgacgttgat
ggcaaggcggtttcggttgggctgtccgcccaggacatcgacgctggtccattcctcaac
ttcaacctgcaacgcaagcaggtccttggccaccttggttacaagtctcaggacatcgcc
ctgctcgccgagatgttgtcctatcaccgcctggacctcacggagtccatctcaaaggtc
atcccgttgaaggatgtcgagagcggcatcgcggagctcgagtcccaccagggcaacccg
atccgtatcctggtcaagccctga

DBGET integrated database retrieval system