KEGG   Cutibacterium acnes C1: PAC1_11925
Entry
PAC1_11925        CDS       T02330                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
pacc  Cutibacterium acnes C1
Pathway
pacc00620  Pyruvate metabolism
pacc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pacc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAC1_11925
Enzymes [BR:pacc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     PAC1_11925
SSDB
Other DBs
NCBI-ProteinID: AFU42121
LinkDB
Position
2497779..2501180
AA seq 1133 aa
MAGTIGSMVTQAHMDSVNLRLALNGLPLPTAARASYIDVVAPVLARQRELRRELPELLCP
ADRRIQAFIDRYLGEDSSVHPRLPDTTLTLDEPGLARALSLPVDGDDFSSDLVSSYRVAN
GVLHNPRNDRRTTAGVFHVAEGGLAIPDDKKAVPIDVFARLLDLAFQAPPEHTLLPYTST
QPVDRQAHTWVSLLLRPLVVPEVPGFVSERRMEIRFFAPGGLVSNLDFVEGIFGNSGDPL
LPVNDSALAPSGWTGHSGCIILAPHLNLIRKVDLGLPHVDQATDRQRRDGMCWSDESELY
NEGKPFKLCARDESGVILTIVADNYFGYCKKEVKTQISYSANLFGLAEEEHSGGARAYIS
HNEGQEYATPVCDQTVSDVVMANPDHFEMLSDGQARVLDIDDVVLVPGGTKFSLRDGTVS
WDNGDHSIRMRADTEYISPAGYRIHMVHNDADDQWYLEGTYGDSTTLHKCCTVSGGGKSE
ISKAISDTFLWGNAYSPDFEADMDAVDDILHRDYSTRFADPKLNGIDHRPVLSTERSVGS
VIKLLTPSSDFTDWYNDWINSIPAFRKELVFTIKRYYKPEWGDDWRSHFSVAPTNGRHGN
MVRLDGQKVLVSMARVGFQPDGSWRLFTLRHDYAPAVKVQTEDDMTASIVTSPGVVTGPE
GLSRKVVANCEALLFQRPDDAIYRGYDTQTERDMSGTDLFISNYQPLTREDVRAMRDDVV
AFSKFTPPMRTFLSNFADSDPSEQPKFVVSSADPRLIDGVRSRNPRYLQVRPDIAKPRET
AIANLASHLYHGLPIDEPLPLPVDVVAAGRRNNPPEGKIPALCAYNPLHYMELPELFMEF
ISSMTGKSPSTTGAGSEGALTKAPFNALPAVFDLNSSFLSFVLSGYDGWLSSAGFIGPKV
EVAHDISLLVPEIFCRMSPAERDAKTLIEGGYLEKLEDYDKDGELILASRLGYRMTEKFM
RAYFGRIFLHPDTVFTPEMLRPELQDADIFADSVRTISTTHARVAKAYFDDGTVSLAVPP
IRALLEIMVNGVCSEGWTLDDPELREMFTRESVLASDWYAERIDAKQAEAVRRAERGIAH
LEQFMADPRNASACEEIDVQARLDQVRKFHDRAVTAEYRQQLVGTLGRQVNFR
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggcaggcacaattggttctatggtcactcaagctcacatggattccgtgaatctaaga
ctggcgctcaacggtctgccactgccgacggctgcgcgcgcttcctacattgacgttgtc
gccccagtcttggcccggcagcgtgagctgaggagggaactccccgagctcctctgcccg
gccgaccgccgtattcaggcattcatcgaccgctacctgggcgaggactcttccgtccac
ccccgactgcccgacaccaccttgacccttgacgagcccggcctcgcacgggccctctcg
ctacccgtcgacggcgacgatttcagttccgaccttgtctcgagttaccgagtggccaac
ggcgtcctacacaatccccgcaatgaccgtcgcaccactgctggtgtattccacgtcgcc
gagggcggactggcaatccccgacgacaagaaggccgtgccgatcgacgtcttcgcccgt
ctgctcgaccttgccttccaggccccacccgagcacaccctgctgccttacacttctacc
caaccggtcgaccgccaggcccacacctgggtttccttgttgctgaggcccctggtggtg
cccgaagtgcccggtttcgtctccgagcgccgcatggagattcggttcttcgcccccggc
gggctggtctccaacctggacttcgtggaggggatctttggtaacagtggcgatcccctt
ctgcccgtgaacgactcggccctcgccccgtcgggttggactggccacagcggctgcatc
atcctcgccccgcatctcaacctcatccgtaaggtagacctcggtctgccccatgtcgac
caggcaaccgaccgtcagcgtcgcgacgggatgtgctggtctgacgagtctgagctctac
aacgagggcaagccattcaagctgtgtgcccgtgacgagtccggggtcatcctcactatc
gtcgccgacaactacttcggctattgcaagaaggaggttaagacccagatctcctactca
gctaacttgttcgggctggccgaggaggagcattccggcggcgcccgcgcctacatctcc
cacaacgagggccaggaatacgccaccccagtctgcgaccagacggtttccgacgtcgtt
atggccaatccggaccacttcgagatgcttagcgacggccaggcccgggtactcgatatc
gacgacgtcgtcctggtgccgggtgggaccaagttcagcctgcgtgacggcactgtcagc
tgggataacggtgaccactcgatccgaatgcgcgctgacaccgagtacatctcccccgcc
ggctaccggattcacatggtccacaacgatgctgacgaccagtggtacctcgagggcact
tacggcgattcgacgactctacataagtgctgcacggtatccggtggtgggaagtcggag
atttccaaggccatatcggacaccttcctgtggggcaatgcctactctccggatttcgag
gccgacatggatgccgtcgatgacatcttgcatcgggactactcgacgcggttcgccgat
cccaagcttaacggcatcgaccatcgtccggtcctctcgacggagcgttcggtgggttcg
gtcatcaagctcctcaccccatcctcggacttcaccgactggtacaacgattggatcaac
tcgattccggccttccgcaaggagctggtcttcaccatcaagcgctactacaagccggaa
tggggtgatgactggcgctcccacttcagcgtcgcccccacaaatggtcgccacggcaac
atggtccgtctcgacggccagaaggtgctggtgagtatggcgcgcgtgggattccagccc
gacggctcgtggcggctgttcaccctgcgccacgattacgctccggccgttaaggtgcaa
accgaggatgacatgacagcgtcaatcgtcacatctccgggcgtagttaccggccctgaa
ggtctgtcgcgcaaagtcgtcgccaactgcgaagcgttgctcttccagcgccctgacgac
gccatttaccgtgggtacgacacccaaaccgagcgtgatatgagcgggacggacttgttc
atctcgaactaccagccgctgacccgcgaggacgtcagggcaatgcgtgacgacgtggtg
gccttctcgaagttcaccccaccgatgcgcaccttcctgtcgaacttcgctgattccgac
ccttcggagcagccaaaattcgtcgtctccagcgccgatcctcgtcttatcgacggggtg
cgttcgcgcaacccacgctacttgcaggtgcgtccagacattgccaagccgcgcgaaacc
gcaatcgccaatcttgccagccacctgtatcacggactgccgatcgacgaaccgctgccc
ctgccggtcgacgtggtcgccgccgggcgtcgcaacaacccgcccgagggcaaaatcccg
gccttgtgtgcgtacaacccactgcactacatggagctgccggaattattcatggagttc
atctcctcgatgactggtaagagtccttcgacgacgggagccggttcggagggagccctg
acgaaggcaccgttcaatgccttgccagcggtcttcgacctcaactcgtccttcctgtcc
ttcgtgctatcggggtatgatggttggttatcctcggccggattcatcggcccgaaggtt
gaggtcgcccacgacatttccctgctcgtcccggaaatcttctgccggatgtccccagcc
gagagggatgccaagacccttatcgagggtggctatctggagaagctggaagattacgat
aaagatggcgaactcattctcgcctcccgtctgggctaccgcatgacggaaaagttcatg
cgcgcctatttcgggcgtatcttcttgcaccccgacaccgtcttcacccctgagatgctg
cgtccggaacttcaggacgccgacatcttcgctgactcggtgcgaacgatctcgactact
cacgctcgagtagctaaggcctatttcgacgacgggacggtctcgctggcggtaccgccc
atccgggctctgctggaaatcatggtcaatggagtttgctcggagggttggactcttgac
gatcccgagttgcgggagatgttcacccgcgagtcagtacttgcctccgactggtacgcc
gagcgtatcgacgccaagcaggccgaagccgtgcggcgcgccgagcgaggaatcgcccac
cttgagcagttcatggctgatccgcgtaacgcgtccgcctgcgaggaaattgacgtccag
gcccgtctggatcaagtccgcaagttccacgatcgcgccgtgacggctgagtaccgccaa
cagttggtgggcactcttggtcggcaggtcaacttccgctga

DBGET integrated database retrieval system