KEGG   Propionibacterium acidifaciens: EGX94_09400Help
Entry
EGX94_09400       CDS       T05713                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pacd  Propionibacterium acidifaciens
Brite
KEGG Orthology (KO) [BR:pacd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EGX94_09400 (ahpF)
Enzymes [BR:pacd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EGX94_09400 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA DAO HI0933_like Thioredoxin_3 FAD_binding_2 FAD_oxidored Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AYW78249
UniProt: A0A3G5HRJ2
LinkDB All DBs
Position
2254519..2256072
Genome map
AA seq 517 aa AA seqDB search
MAVLDEKLIDQLRALMDRITRPVEFVVSLDDRSASARLDEMLGQVAALSERISVRRDDGA
HERRPSFTITSPGTGIAITFAAVPLGHEFTSFALALLQVGGNPVKLDERVVEAVRSIRAE
QEFVTYISLTCQNCPTVVQTINAMAVLNPLIRHTVVDGSLFRDEVESRNVLATPTVYRNG
ELLGQGRMEAARIIAAVDAGAAGAVETGLADRKPYQVLVIGQGPAGVSAAVYLARKGIRT
GLVGDRFGGQVNDTLAIENLISVPHTEGPKLAADLRAHAEQYDIDIIDGVTASGIDRADD
GALAVRLGGAALTARAVVLATGAGWRRMGVPGEDEYRNKGVTYCPHCDGPLFKGRDVAVI
GGGNSGVEAALDLAGVARHVTVLEFMPECRADEVLLRRMAESPAIDVVTNAAVAEVLGDG
SRVRAVRYEDRAGGAGAELGVDGVFVQIGQVPNTGWLDGAVELDDRGQVVVDAKGATSMP
GVFAAGDCTDAPYKQIVIASGAGATAALSAWEHLVRG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcctcgacgagaaactcatcgaccagctgcgcgcgctcatggaccgcatcacc
cggcccgtcgagttcgtcgtgagcctcgacgaccgcagcgcgtccgcccggctcgacgag
atgctcgggcaggtcgcggccctgtccgagcgcatcagcgtccgccgcgacgacggcgcc
cacgagcgcaggccgtcgttcacgatcacctcgcccggcaccgggatcgccatcacgttc
gccgcggtgcccctgggccacgagttcacctcgttcgccctcgcgctgctccaggtcggc
ggcaatcccgtcaagctggacgagcgggtcgtcgaggcggtccggtcgatccgggccgag
caggagttcgtcacctacatctcgctgacctgccagaactgcccgaccgtcgtccagacg
atcaacgccatggcggtcctcaacccgctgatccggcacaccgtcgtcgacggctcgctg
ttccgcgacgaggtcgagtccaggaacgtcctggccaccccgaccgtctaccgcaacggc
gagctgctcggccagggccgcatggaggccgcccggatcatcgccgctgtcgacgccggg
gcggccggggcggtcgagaccggcctcgccgaccggaagccctaccaggtgctcgtcatc
ggccagggccccgccggcgtctcggccgccgtctacctggcccgcaagggcatccgcacc
gggctcgtcggcgaccgcttcggcgggcaggtcaacgacacgctggccatcgagaacctc
atctcggtgccgcacaccgagggccccaagctggccgccgacctgcgcgcccatgccgag
cagtacgacatcgacatcatcgacggcgtcacggcctccggcatcgaccgggcggacgac
ggcgccctcgccgtccggctgggcggggccgccctcacggcccgcgccgtcgtcctggcc
accggagccggctggcgccgcatgggcgtgcccggcgaggacgagtaccgcaacaagggg
gtcacctactgcccccactgcgacggccccctcttcaagggcagggacgtggcggtcatc
ggcggcggcaattccggtgtcgaggcggcgctcgacctggcaggcgtcgcccggcacgtc
accgtcctcgagttcatgcccgagtgcagggccgacgaggtcctgctccggcgcatggcc
gagtccccggccatcgacgtcgtgacgaacgccgccgtggccgaggtgctcggcgacggc
tcccgggtgcgggcggtccgctacgaggaccgcgccggcggcgcgggcgccgagctcggc
gtcgacggcgtcttcgtccagatcggccaggtgccgaacaccggctggttggacggggcc
gtcgagctcgacgaccggggtcaggtcgtcgtcgacgccaagggcgccacgagcatgccg
ggcgtcttcgccgccggcgactgcacggacgccccgtacaagcagatcgtcatcgcctcg
ggcgccggcgccacggcggccctgtcggcctgggagcacctggtccgcggctga

DBGET integrated database retrieval system