KEGG   Pelobacter acetylenicus: A6070_02540Help
Entry
A6070_02540       CDS       T04585                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
pace  Pelobacter acetylenicus
Pathway
pace00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pace00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A6070_02540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pace01003]
    A6070_02540
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pace01011]
    A6070_02540
Enzymes [BR:pace01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     A6070_02540
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A6070_02540
Glycosyltransferases [BR:pace01003]
 Polysaccharide
  Bacterial polysaccharide
   A6070_02540
Peptidoglycan biosynthesis and degradation proteins [BR:pace01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   A6070_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: APG43133
UniProt: A0A1L3GGH7
LinkDB All DBs
Position
555112..557409
Genome map
AA seq 765 aa AA seqDB search
MAVRKVSARSVGKRVFLYGMMVSLLTFGLYAIYLDFAVRERFEGKRFALPARVYARPLEL
YPGLKLTPADLAAELALLGYRQVKSPLEPATYRWEGRQLDLVTRSFVYGDGPQPPILCSV
AFSEGRIVSLTDRKRRSAQQLVRLDPALIGGIFPGKNEDRVLIELRTVPRLVVDALLAVE
DRRYYRHHGIDPRGMARALLMTLSGKSVQGGSTITQQLVKNFYLTAERTLRRKFTEMIMA
VLLEMHYSKEEILETYLNEVYLGQDGNRAIHGFGLASVHFFDKPLSRLRPAEAALLVGLL
KGPAYYSPRNHPRRALDRRNLVLSQMVEAGFLPEQQAAEARAMPLGVVERPPRGTSPYPA
FLKLVHRQLQRDYRDEDLRSEGLLIFTTLDPRVQRMAEEAVQKHLAHLEAIRGIKSGTLQ
GAAIFTDTQSAEVQACVGGREPRFEGFNRVVDARRPVGSLIKPVVFLTALQHPSRYTLAT
LLDDGPLVYRQAGAEDWIPQNYDKQHHGKVSMREALIHSYNVATVRLGLSVGVDSVMANI
RQLGVERELTGFAASLLGADALSPLEVAQLYQTLAGGGFRTPLRAIREVLTAEGEPLQRY
PLNVEQVIRPAPVYLVTTALQSVVREGTAQKLYNRLSPDLGIAGKTGTTDDYRDSWFAGF
TGDRLGVVWVGRDDNEPAGFSGAGAAMGIWGDIMVGLDPEPLALVPPDNVEWVWIDPASG
LRSAANCPGAVELPFISGSAPTRSADCGPHSVGHRIKTWFKGLFE
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcgcaaggtgtccgcacgcagcgttggcaagcgggtttttctgtatggcatg
atggtcagcctgctgaccttcggtctttatgcgatttatctcgattttgccgtaagggag
cggtttgaaggcaagcgtttcgccttgcccgcgcgggtttatgcgcggccgctcgaattg
tacccgggactgaagctcacccctgccgatctggccgccgagttggccctgctcggatac
cggcaggtgaaatctccactggagccggcgacctaccgatgggaaggtcgacagttggac
ctggttacccggtcgttcgtgtatggcgacggccctcagccgccgattttatgcagcgtg
gctttctccgaaggacgtatcgtatccctgaccgaccgcaaacggcgttcggcccagcag
ctggtgcgcctcgatccggcccttatcggcggcattttccccggcaagaacgaggaccgg
gtgctgattgaactgcggaccgtgccccggctggtggtggatgcgctattggccgtcgag
gatcgccgctattaccggcaccatggcatcgatccccgggggatggcccgcgcgctgctc
atgaccctcagtggcaaaagcgttcagggtggcagcaccatcacccagcaactggtgaaa
aatttctacctgacggcggagcgcaccctgcggcgcaagttcacggaaatgatcatggcc
gtgctgctggagatgcattacagcaaggaggaaattctcgaaacctatctcaatgaggtt
tatttaggtcaggacggcaaccgggccattcacgggtttggccttgccagtgtccatttt
tttgacaaacccctgtcccgtcttcgtcccgccgaagccgcgctgctggtaggcctgctg
aaaggtccggcctactacagcccgcgcaaccacccccggcgggctctggacagacgcaac
ctggttttgtctcagatggtcgaggccggatttctgcccgaacaacaggccgcggaagcc
agagcgatgcccctgggagtggttgaacggcctccccgtggcacctctccctacccggca
tttctgaagctggtgcatcgccagttgcagcgtgattatcgagacgaggatctgcgatca
gaggggttgttgatttttaccacgcttgatccccgggtgcagcgcatggcggaagaagcg
gtgcaaaaacatctggcgcatctggaagcgatacgtggcattaaatccggcaccctgcag
ggggcggctatcttcaccgacacgcaaagtgccgaggtgcaggcttgtgtgggcgggcgg
gagccgcgtttcgaggggttcaaccgggttgtcgatgccaggcggcctgtcggatcgctg
atcaagccggttgtttttctgaccgcactgcagcatccttcccgatacactcttgcaacc
ctgctggacgacggtccgctggtttatcggcaggccggagctgaagactggattccgcag
aactatgacaagcagcatcacggcaaggtgtcgatgcgcgaggccctgattcattcctat
aacgtggccacggtccggctcgggttgtcggtgggggtggattcggtgatggccaatatc
cggcagctcggcgtggagcgtgaactgaccggttttgccgccagcctgctgggggcggat
gccctgtccccccttgaagtcgcgcagctctaccagaccctcgccggaggcggtttccgt
acgccgctgcgggccattcgggaggtacttacggccgaaggcgaaccgctgcaacgatat
cccctgaatgtggagcaggtcatcaggccggcccctgtttatctggtaaccaccgcactg
cagtccgtggtccgcgaagggaccgctcaaaagttgtacaaccggctgtcgcctgatctg
ggtattgccggcaagaccggtaccaccgacgactaccgggatagctggtttgcgggattt
accggtgaccgtctcggtgtggtatgggtggggcgggacgataacgaacctgccggattc
agcggcgctggcgccgccatgggcatctggggcgatattatggtcggacttgatcccgaa
cccttggcccttgtgccgccggacaatgtggagtgggtatggattgatcccgcatcggga
ttgcgcagtgccgcaaactgcccgggtgccgtggaactgccttttatctccggttcggcc
ccaacccgcagcgccgattgtggtccacattcggtgggccatcggatcaaaacctggttt
aaagggttattcgagtga

DBGET integrated database retrieval system