KEGG   Pelobacter acetylenicus: A6070_02695Help
Entry
A6070_02695       CDS       T04585                                 

Definition
(GenBank) hypothetical protein
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pace  Pelobacter acetylenicus
Pathway
pace00030  Pentose phosphate pathway
pace01100  Metabolic pathways
pace01120  Microbial metabolism in diverse environments
pace01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A6070_02695
Enzymes [BR:pace01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A6070_02695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: APG43160
UniProt: A0A1L3GGS1
LinkDB All DBs
Position
579463..581349
Genome map
AA seq 628 aa AA seqDB search
MLGGYWQKIAVIDLTTETVEYLRPSEEDLKKFIGGSGLGAKLLYENTRAGIDPLGPENVL
ICMTGPYNGTKVAQAGRWELITKGPLTGIYLESDCGGKWGGALKACGLDGLMVKGKAKQP
VYITIVDDDIQIKKADQLWGKGTFETDRLLKEELGKGSQAISIGQAGEKLVKIASIMTDG
REGRTAGRGGGGAVMGSKNLKAIACKGSKNVPIARPEPYEEMIQKFRENFKDVYDGPLGT
YGTSCAVEIFNDVGDLPIKNWLWGHWDKAEKVSGQHLAKTILKKRYHCGNCLIGCGRTVE
IPSGAFKMEKGGGPEYETLGMLGSNCLIDDVEAISKGAEFCNDYGIDTISASALISFLME
AWEHGMIDESDTDGLEMTWGNGLAMVEMIRKIALREGIGDPCSQGILEAIKRVGPASAEF
AVHVKGMDFPAHDPRGRGGLGVAYATSNRGACHMQAYNQDFEGEGCLNIADLGYDAPMPP
YTNEGKGKFVADMQNFMSMMDSLKLCKFSVFGGMTVGPMTQFLNHIVGWDLTNEQWIECG
ERIFNMKRLFNTREGVSRKDDTLPPRILASPRQGGSGDYVPDLGYQLRDYYRARNWDEWG
IPTPETLKRLGLDQYDYRKGKRTTENQR
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgttaggtgggtactggcagaaaatcgcggtaatcgatttgaccacggaaacagtggaa
tatctcaggcccagtgaagaagacctgaaaaaatttattggcggcagcggacttggcgcc
aagcttctgtacgaaaacaccagggcgggtatcgatccgctgggaccggaaaatgtactg
atctgcatgaccgggccgtacaacgggaccaaggtggctcaggcgggacgctgggagctg
attaccaagggacccctgaccggcatttacctcgaatccgactgcggggggaaatggggc
ggcgcccttaaagcctgcggccttgacggtcttatggtcaagggcaaggccaaacagcca
gtgtatatcaccatcgtcgacgacgatatccagatcaaaaaagccgaccagctgtggggt
aaaggcacctttgaaaccgacaggcttctcaaggaagagctgggcaaaggttcccaggcc
atttccatcggacaggccggagaaaaattggtcaagatagcctccatcatgaccgatggt
cgcgagggccgcaccgcggggcgcggcggcggcggcgccgtcatgggttccaaaaatctc
aaggcgatcgcttgcaagggcagcaagaatgtccccattgccaggcccgagccttatgaa
gaaatgattcagaaattccgcgaaaacttcaaggatgtctacgatggaccgcttggcacc
tacggtacatcctgcgccgtggaaattttcaacgatgtcggtgacctgccgatcaagaac
tggctgtggggccattgggacaaggctgaaaaggtttccggccagcacctggccaagacc
attctcaaaaagcgttaccattgcggcaactgcttgattggttgcggccgtaccgtggaa
atcccttctggtgcgttcaagatggagaaggggggcggtcccgaatacgaaacccttggc
atgctcggttccaactgtctgattgatgatgtggaagccatctccaagggtgcggaattc
tgcaacgattatggcatcgataccatctccgcctccgctctcatcagtttccttatggaa
gcctgggagcatggcatgatcgacgagagcgacacggatggcctggagatgacctggggc
aacggcttggccatggtcgagatgatcaggaagatcgccctgcgcgaaggcatcggggat
ccctgctcccagggcatcctggaagccatcaagcgggttggccccgccagtgcggaattc
gccgttcacgtcaagggcatggacttccccgcgcatgacccccgcggccgcggcggtctc
ggcgttgcctatgccacctccaaccggggtgcctgccacatgcaggcctataaccaggac
ttcgagggagaaggctgcctgaatatcgcggacctcggctacgacgccccgatgcccccc
tataccaatgaaggaaagggcaagttcgttgccgacatgcagaatttcatgagcatgatg
gattcgctgaaactctgcaaattctccgtgttcggcggtatgactgtcgggcccatgacg
cagtttctcaaccatatcgtcggctgggacctcaccaacgagcaatggatcgagtgcggc
gagcggattttcaatatgaaacgtctgttcaacacccgcgagggggtcagccgcaaggac
gacaccctgccgccgcgtatccttgccagcccccgccagggcggctccggcgattacgtg
cccgacctgggctaccagctgcgggattactaccgcgcccgcaactgggacgagtggggt
atccccactccggaaaccctcaagcggctcggccttgaccagtatgattaccgcaagggc
aagcgcaccaccgaaaatcagcgctga

DBGET integrated database retrieval system