KEGG   Cutibacterium acnes HL096PA1: PAGK_0647Help
Entry
PAGK_0647         CDS       T02638                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pach  Cutibacterium acnes HL096PA1
Pathway
pach00061  Fatty acid biosynthesis
pach00780  Biotin metabolism
pach01100  Metabolic pathways
pach01130  Biosynthesis of antibiotics
pach01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pach00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAGK_0647
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PAGK_0647
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PAGK_0647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pach01004]
    PAGK_0647
Enzymes [BR:pach01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PAGK_0647
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PAGK_0647
Lipid biosynthesis proteins [BR:pach01004]
 Fatty acid synthase
  Component type
   PAGK_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AGJ79495
LinkDB All DBs
Position
738756..739529
Genome map
AA seq 257 aa AA seqDB search
MGLLEGRTVLVTGVTMHTSIAFKAAQIAQDEGARVIVSNLPRAVGVTRRAVRKLDPVPEV
LELDVTDADQLAALPQQLRDLGVEKLDGVVHAIAFANPKTALGGKFLETEWDDVSVAVHT
STYSYVSLMTALVDILAEHASVVGLTFDATVSWPFYDWMGVAKAGLESANRYLARYLGPK
GVRCNLVSAGPLDTMAKTAIPGADAFNDVWGERAPLGWDTKDTTPAAKGIVALLSDWFPA
TTGEIIHVDGGMGSTGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggacttcttgaaggacgtaccgtcctcgtcacaggcgtgacgatgcacacctctatc
gcttttaaggcggcccagattgcccaggatgagggcgcccgggttattgtttcgaacctg
ccgcgtgccgtcggcgtcacccgtcgagctgttcgcaaactcgatccggtgccggaggta
ctcgaactcgatgtcaccgacgccgaccagctggctgccctgcctcagcaactgcgcgac
ctcggagtggaaaagcttgatggtgtcgttcacgccatcgccttcgctaaccccaagacg
gccctggggggcaagtttctcgaaacggaatgggatgacgtctcggtcgctgtccacacc
tccacgtattcttatgtctccttgatgaccgcccttgtcgacatcctcgccgagcatgct
tcggtcgtcggtctgacctttgacgccaccgtctcctggcccttctacgactggatggga
gtggccaaggcgggactggaatcggccaatcgctacctggctcgatacctgggccccaaa
ggtgtgcgctgcaacctagtgtccgctggtccgctggacaccatggctaaaacagctatt
ccgggcgctgatgcctttaatgatgtgtggggggagcgtgccccgcttggctgggacacc
aaggacaccacgcccgcggccaagggaattgttgccctcttgtctgactggttcccagcc
actaccggcgagataatccacgtcgatggcggtatgggttcgaccggagcttga

DBGET integrated database retrieval system