KEGG   Cutibacterium acnes HL096PA1: PAGK_0746Help
Entry
PAGK_0746         CDS       T02638                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pach  Cutibacterium acnes HL096PA1
Pathway
pach00020  Citrate cycle (TCA cycle)
pach00190  Oxidative phosphorylation
pach00650  Butanoate metabolism
pach01100  Metabolic pathways
pach01110  Biosynthesis of secondary metabolites
pach01120  Microbial metabolism in diverse environments
pach01130  Biosynthesis of antibiotics
pach01200  Carbon metabolism
Module
pach_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pach_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pach00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAGK_0746
   00650 Butanoate metabolism
    PAGK_0746
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAGK_0746
Enzymes [BR:pach01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PAGK_0746
    1.3.5.4  fumarate reductase (quinol)
     PAGK_0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 GIDA HI0933_like NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGJ79593
LinkDB All DBs
Position
844475..846502
Genome map
AA seq 675 aa AA seqDB search
MTATAVSNNNAALADQYWTTGDEIHDTKANHDLPIEKIWTDRQFTSRLVNPANRRKMTVI
IVGTGLAGGAAAATLGEAGYRVENFCYQDSPRRAHSIAAQGGINAAKNYKNDGDSIYRLF
YDTVKGGDYRSRETNVYRLAAVSANIIDQCVAQGVPFAREYGGLLDNRSFGGVQVQRTFY
ARGQTGQQLLIGAYQALERQVHAGTVHMHTRHEMVELIVADGRARGIVTRDMVTGKIEEW
FGDAVVLATGGYGNVFFLSTNAMGCNATASWRAHRKGAYFGNPCYTQIHPTCIPVHGENQ
SKLTLMSESLRNDGRIWVPKRAEDCEKDPRDIPEEDRDYYLERIYPSFGNLVPRDIASRQ
AKYRCDEGRGVGPKVREVDSDGTEHMRARGVYLDFSEAIQRMGKDAVEKKYGNLFDMYQR
ITDENPYEVPMRIYPAVHYTMGGLWVDYDLQSTIPGLFVCGEANFSDHGANRLGASALMQ
GLADGYWVLPNTITDYLADSPKFGMVDEKHPAAVEARQAVESRINKLLTINGTRTVDSIH
KELGHIMWEYCGMERSEAGLIKAIGLIRNLRNEFWTNVKVTGVNEELNQTLERAGRLADF
LELGELMCIDALHRRESCGGHFRAESQTEEGEAMRHDDEYQYVAAWEWTGEGHKPTLHKE
PLVYKSIQVKQRSYK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaactgctgtatccaataacaacgccgctctcgccgaccagtactggacgacc
ggcgacgaaatccacgacacgaaggccaaccatgaccttccgatcgagaagatctggact
gatcgccagttcacctcgcgtctggtcaacccggctaaccgtcgcaagatgacggtcatc
attgttggtaccggtctagctggtggcgctgccgccgcaactctcggtgaggccggttac
cgcgtcgagaacttctgctaccaggactctccgcgtcgcgctcactcgatcgcggcccag
ggcggaattaacgccgcgaagaactacaagaatgacggtgattcgatctaccgcctgttc
tacgacaccgtcaaaggtggcgattaccgctcccgcgagacgaacgtttaccggctcgcc
gcggtcagcgcgaacatcatcgaccagtgtgtcgcccagggcgttccgttcgcccgtgag
tacggtggcctgctcgacaaccgttccttcggtggcgtccaggtgcagcgcaccttctac
gctcgcggccagacgggccagcagctgctcatcggcgcctaccaagccctcgagcggcag
gttcacgccggcaccgtgcatatgcacacccgtcacgagatggtcgagctcatcgtcgcc
gacgggcgagctcgcggcatcgtgactcgtgacatggttaccggcaagatcgaagagtgg
tttggtgacgccgtcgtcctggctaccggtggttacggcaacgtcttcttcctgtcgacg
aacgccatgggctgcaatgccaccgcctcgtggcgtgcccaccgtaagggcgcttacttc
ggcaacccctgctacacccagatccacccgacctgcatcccggtgcatggtgaaaaccag
tcgaagctgactctgatgtcggagtcgctgcgtaacgacggccgtatctgggtgcccaag
cgcgcggaagattgtgaaaaggatcctcgcgacatccccgaggaagatcgcgactactac
ttggagcgcatctacccgtccttcggcaacctggttcctcgtgacattgcatcccgtcaa
gccaagtaccgctgtgacgagggtcgtggtgtcggtccgaaggttcgtgaggtcgattct
gacggcaccgagcacatgcgtgcccgtggtgtgtacctcgacttctccgaggccatccag
cgtatgggtaaggatgccgtggaaaagaagtacggcaacctcttcgacatgtaccagcgg
attaccgacgagaacccgtatgaggttcccatgcgtatctaccctgcggtgcactacacg
atgggtggcctgtgggtcgactatgacctgcagtcgaccattccgggtctgtttgtctgt
ggtgaggccaacttctccgatcacggcgctaaccggctcggtgcttcggccctgatgcag
ggtctggctgatggctactgggtgctgcccaacaccatcaccgattacctggcggactct
ccgaagttcggcatggtcgatgagaagcatccggccgcggttgaagcccgtcaggctgtc
gagagccgtatcaacaagctgctaacgattaatggaacccgtaccgtcgactcgatccac
aaggaacttggccacatcatgtgggagtactgcggtatggagcgcagcgaggccggcctc
attaaggctattggtctcatccgcaatctgcgcaacgagttctggaccaacgttaaggtc
accggcgtcaacgaggagctcaatcagaccctcgagcgcgctggtcggctcgccgacttc
ttggagctcggtgaactgatgtgcatcgacgctctacaccgtcgcgagtcttgtggtggt
cacttccgcgctgagtctcagaccgaagagggcgaggccatgcgtcacgacgacgagtat
cagtacgtcgctgcctgggagtggactggcgaaggccacaagccgaccctgcacaaggag
ccgctggtctacaagtccatccaggtcaagcagaggagctacaagtga

DBGET integrated database retrieval system