KEGG   Cutibacterium acnes HL096PA1: PAGK_0747Help
Entry
PAGK_0747         CDS       T02638                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pach  Cutibacterium acnes HL096PA1
Pathway
pach00020  Citrate cycle (TCA cycle)
pach00190  Oxidative phosphorylation
pach00650  Butanoate metabolism
pach01100  Metabolic pathways
pach01110  Biosynthesis of secondary metabolites
pach01120  Microbial metabolism in diverse environments
pach01130  Biosynthesis of antibiotics
pach01200  Carbon metabolism
Module
pach_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pach_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pach00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAGK_0747
   00650 Butanoate metabolism
    PAGK_0747
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAGK_0747
Enzymes [BR:pach01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PAGK_0747
    1.3.5.4  fumarate reductase (quinol)
     PAGK_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_7 Fer4_10 Fer4_9 Fer4_18 Fer4 Fer4_6 Fer4_2 Fer4_15 Fer4_4 Fer4_16 Fer4_3 Fer4_21 Fer4_13 Fer4_22 Fer2
Motif
Other DBs
NCBI-ProteinID: AGJ79594
LinkDB All DBs
Position
846499..847272
Genome map
AA seq 257 aa AA seqDB search
MKINLRIWRQRNSKDQGRLVEYTLDGVSGDMSFLEMLDMLNENLTAQGEEPVAFDSDCRE
GICGQCGIVINGVPHGGMGVAQPVRTTTCQLHMRSFADGSTITIEPWKSGAFPILRDLIV
DRSALDRVIQAGGYVSVNTGAAPDAHAVQVNKKRSDRSFDAATCIGCGACVAACPNGSSM
LFTSAKITHLAMLPQGQPERMRRVKAMAAQNDAEGFGGCTNIGECASVCPKGIPLESISQ
LNRDLIASLFKHDGKDD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcaacctgcgaatctggcgtcagcgcaattccaaggatcagggccgcctcgtc
gagtacaccctggacggtgtttccggtgatatgtccttccttgagatgttggacatgctc
aacgagaacctcaccgctcagggtgaagagcccgtcgcatttgactcggactgccgcgag
ggtatttgcggtcagtgcggcatcgtcatcaatggtgtgccgcacggtggtatgggtgtt
gcccagccggtgcgtaccactacgtgtcagctgcacatgcgctccttcgccgatggctcg
accatcacgatcgagccatggaagtcaggtgccttcccgattctgcgtgaccttatcgtg
gatcgctcggcccttgaccgtgtcatccaggctggcggctatgtctcggtgaacaccggt
gctgccccggacgctcacgctgttcaggtcaacaagaagcgctctgaccgctccttcgac
gccgctacctgcatcggttgtggcgcctgcgtggcggcctgcccgaacggctcctcgatg
ctgtttacttctgcgaagatcactcacctggccatgcttccgcagggtcagccggagcgg
atgcgtcgtgttaaggctatggctgcgcagaacgacgctgaaggattcggtggctgcacc
aacattggtgagtgcgcctcggtgtgcccgaaaggtattccgctggagtccatcagccag
ctcaaccgcgacctcattgcgtcgctgttcaagcacgacggcaaggacgactga

DBGET integrated database retrieval system