KEGG   Cutibacterium acnes HL096PA1: PAGK_1443Help
Entry
PAGK_1443         CDS       T02638                                 

Definition
(GenBank) sialidase A precursor
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
pach  Cutibacterium acnes HL096PA1
Pathway
pach00511  Other glycan degradation
pach00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pach00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PAGK_1443
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PAGK_1443
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:pach02042]
    PAGK_1443
Enzymes [BR:pach01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PAGK_1443
Bacterial toxins [BR:pach02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PAGK_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 Laminin_G_2 BNR_3 BNR Laminin_G_1 PSII_BNR
Motif
Other DBs
NCBI-ProteinID: AGJ80267
LinkDB All DBs
Position
1605971..1608286
Genome map
AA seq 771 aa AA seqDB search
MTITDTYTEELAIDLTGSALMPARKGMDVQRIDGEDGSLLVEFSATSSGCLFELVGKNGR
LSVDVDEDRLLGRIDLNGESRSLDAEDALGMADGTIHSVGLTADETGTHLFADGYETFSA
TLRVWCQDLGATNIVINPSGVLDVRRFKMWNSALSLQAMAAKAPTATPFVEFAGSELSAR
DARRIGELAHGALRARTRLRGKGQGGTVLAAQGSAGELSFEIVNGDLLLHVEVDDEPIAH
VRAPGKWDDGNWHDLVAISGRGAIDLYVDGFLVAHEPGEAFFADLGKVERVTVGKDLEGA
RLFGEAQTASIFSSALTDAQVKRLANVAPLRTQALFDTGYLGSKSYRIPSLIRLDSGSFI
AGADQRVSIANDSPNDINFVIRRSEDGRRWDEAQIVLEYPGEGALGASVIDSVLFQDHNS
GRVFCLIDQFPGGVGQPNAEPGSGFDEQGRQLLFDRDATAYVIDAEGIVTTESGEPTDYT
VDETGNVFAAGAPAGNIHLATGVDPHESLLTLRTCNLILIHSDDDGRTWSRPINLNPALK
QPWMRFLGTSPGNGIQLEHGTHRGRLLAPVYYNHEEGKTFSCAAVYSDDGGQTWNLGKSP
NDERELFGKIVSSRNLNDDRGSTHESALVETPDGVVHSFMRNQHPSGRVAHAASVDGGET
WGEVTFVEQLTEIFSQPNAISVRDELGTESVVFANASMMLPFRGCGVLRQSFDGGKTWPH
NRVLNPRHHVYQCMTQQDEQTLLVLWEREWQGLFLTEVPLSWLTTSRSTLE
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactattactgatacttataccgaggaattggcgattgacctcactgggagcgccttg
atgccggcccgaaagggcatggacgtgcaacgaatcgacggcgaggacggctcacttctc
gtggaattcagcgcgacgtcctccggatgcctgttcgagcttgtcggaaagaacggacgg
ttatcagtcgatgtggatgaagaccgcttgcttggccgtatagatctgaacggagaatct
cgcagtctcgacgccgaggatgcgctgggcatggcagatggcacgattcactccgtcgga
ctcaccgccgatgaaactgggacgcatttgtttgcagacggttacgaaacattctccgcc
acattgcgggtatggtgccaggatctgggagcaaccaatattgtcatcaatccgtcgggc
gtcctcgacgtacggcgattcaagatgtggaactcagccctgtccttgcaagctatggcg
gccaaggcgccgacggcaacaccgttcgtcgagttcgctggttctgaactgtcggcccgc
gacgcacgccgtatcggagaactcgctcatggcgcgctccgagcaaggacccgtcttcgt
ggcaaaggccagggtggaaccgtcctcgcagcccaagggagcgccggtgaactgtccttc
gagatcgtcaacggcgacctgctcctgcacgtggaagtggacgatgaacccatcgcccac
gtgcgcgctccaggcaagtgggacgacggaaactggcatgacctggtagcaatcagtggc
cggggtgccattgatctctatgttgacggtttcctcgtggctcacgagcctggtgaggca
ttctttgccgatcttggcaaggtggaaagggtgaccgtcgggaaggacctcgaaggagca
cggctattcggggaagcacagacggcgtccatcttcagcagtgcgctaaccgacgcccaa
gtcaaacgcctagccaacgtggctcctctacgtacccaagctctcttcgacacgggatat
ctgggctcgaaaagttaccggatcccatcgctcatcagacttgattccggaagcttcatc
gccggggcagaccaacgtgtcagcattgccaacgacagccccaacgacatcaatttcgtc
atccgtcgcagcgaagacggtcgtcggtgggacgaggcccagatagtcctcgagtatccc
ggcgagggcgccctcggagcatcggttatcgactcagttctgttccaagaccacaactcg
gggcgcgtgttctgcttgatcgaccagttcccgggtggcgtggggcagcctaacgccgaa
ccagggtcgggcttcgatgagcaaggtcggcagcttctgttcgatcgcgatgcaaccgcc
tacgtcatcgatgcagaaggcatcgtaacaaccgagtcgggggaacccacggattacacc
gttgacgaaaccggaaacgtcttcgcagccggtgcccccgccggcaatatccacttggcc
accggagtggacccccacgagtccctgctgaccctacggacctgcaacctcatcctcatc
cacagtgatgacgacggacggacatggtcacgacctatcaacctgaacccggctctcaag
cagccttggatgcggttcctcggtacgtcaccgggcaacggaattcagttggaacacggg
acgcaccgaggccgactcctggcaccggtctactacaaccacgaggagggaaaaaccttt
tcatgtgccgcggtgtacagcgatgacgggggccagacatggaacctcggtaagtcaccg
aatgacgagcgcgaacttttcggaaagatcgtcagttctcgaaatctcaacgatgatcgc
ggctcgacccatgagtcagcgttagtagaaacccctgacggggtcgtgcactccttcatg
cgcaaccaacatccctccggacgggtggcgcacgcggccagcgtcgacggcggcgaaaca
tggggcgaggtgacgttcgtcgagcaactgaccgaaatcttctcccagcccaatgccatt
tctgtccgggatgagcttggaaccgaatcggtggtctttgccaatgcgtcgatgatgctc
ccgttccggggttgtggtgtgctgcgtcaaagtttcgacggaggcaagacctggccgcac
aaccgcgtgctcaaccctcgccatcatgtgtaccaatgcatgactcagcaagacgaacag
accctgctcgtattgtgggaacgggagtggcaaggcttgttcctgacagaggtcccgttg
tcatggcttaccacttcgcgcagcacgctggagtga

DBGET integrated database retrieval system