KEGG   Pediococcus acidilactici: A4V11_00360Help
Entry
A4V11_00360       CDS       T04512                                 

Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
paci  Pediococcus acidilactici
Pathway
paci00030  Pentose phosphate pathway
paci00680  Methane metabolism
paci01100  Metabolic pathways
paci01120  Microbial metabolism in diverse environments
paci01200  Carbon metabolism
paci01230  Biosynthesis of amino acids
Module
paci_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
paci_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:paci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A4V11_00360
  09102 Energy metabolism
   00680 Methane metabolism
    A4V11_00360
Enzymes [BR:paci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     A4V11_00360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase IGPS QRPTase_C bMG3
Motif
Other DBs
NCBI-ProteinID: AOW73541
LinkDB All DBs
Position
84408..85031
Genome map
AA seq 207 aa AA seqDB search
MKLQVAIDRVSLNEALELARKLDPIVDIIELGTSIVKDYGLVHLKEQVLDFNNAQLLLDL
KTNDEGIYEFKQGYKAGADILTVMATSSSSTVRQVYNVAMESNKQVLIDLMEADNQTISS
IADLENAIFGVHHPKDAGSGFDAVKTVEEFHERFPQVKHIAVAGGIDLEQARKLAKQGIS
ETIIVGSKIVGASDVIATAKEFMEVIR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaagttgcaattgatcgagtttccttaaacgaagcgttggaactagcccgc
aaacttgatccaatcgtcgatattattgagttaggaacctcgatagtaaaagattacggt
ttagtacacctaaaagagcaagtgttagacttcaacaatgcccaattgttattagaccta
aaaacaaatgatgaaggaatatatgaatttaaacaagggtataaagctggtgcggatatt
ttaacagtgatggctactagctcgagttctacagttagacaggtttacaatgttgcaatg
gagtccaataaacaagtattaattgacttaatggaagctgataatcagacgatcagttca
atcgctgatttagaaaatgctattttcggggtacaccatcctaaagatgccgggtcagga
tttgatgccgtgaaaaccgtagaagagtttcacgaacggtttcctcaagttaaacatatt
gccgtggctgggggaattgatctagagcaagctagaaaacttgctaaacaaggtatttcg
gaaacaattatcgttggtagtaaaatagttggcgcatccgatgttatagcaactgctaaa
gaatttatggaggtaatcagatga

DBGET integrated database retrieval system