KEGG   Pediococcus acidilactici: A4V11_06190Help
Entry
A4V11_06190       CDS       T04512                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
paci  Pediococcus acidilactici
Pathway
paci00250  Alanine, aspartate and glutamate metabolism
paci00430  Taurine and hypotaurine metabolism
paci00650  Butanoate metabolism
paci01100  Metabolic pathways
paci01110  Biosynthesis of secondary metabolites
paci01120  Microbial metabolism in diverse environments
paci02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:paci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A4V11_06190
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A4V11_06190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4V11_06190
   00430 Taurine and hypotaurine metabolism
    A4V11_06190
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A4V11_06190
Enzymes [BR:paci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A4V11_06190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Sigma_reg_C
Motif
Other DBs
NCBI-ProteinID: AOW74623
LinkDB All DBs
Position
complement(1266281..1267717)
Genome map
AA seq 478 aa AA seqDB search
MEKEQILDEIGLEQNFLGSIESGQSLPTDVMPEHPMPANIASQLVEHYRLNEAKANQNLA
TFCTTQMEPEAEKLMTNALNTNAIDKSEYPKTAAMENYCVSMLAHLWGIPKNEKMYKDFI
GTSTVGSSEGCMLGGLALLMNWKHRAENIGFDIKDLHHHQPNLVIMSGYQVVWEKFCTYW
NVELRQVPIDQDHMSMDMDRVMDYVDENTIGIVGIQGITYTGAVDDIQRLDKLVDEYNKS
AVMPVKIHVDGAFGAMFAPFVDGFNPWDFRLKNVVSINVSGHKYGMVYPGVGWIVWRHNT
EEYLPKEMRFEVPYLGSTVDSIAINFSHSGAHVVGQYYNFIRFGFKGYKAIMENVRNVSK
KITNELENIGIFEIVNDGSQLPINCWKLADNADVNWNLYDLESELSKFGWQVPAYPLPKN
RQDTTISRIVVRPSMSMTITNDFIDDLHMAIHNLNEQHGGVVEDEAEAEVSSAMTINK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagagcagattttagatgaaattggtttagaacagaactttttaggtagtatt
gaatcaggccagtcattaccgactgatgttatgcctgaacatccaatgccagcaaacatc
gcttcacagcttgttgaacactaccgtcttaacgaagcaaaagcaaatcaaaatctagca
actttctgtacaacacaaatggaaccagaggctgaaaaattaatgacaaacgctttgaat
actaatgccattgacaagtcagaatatccaaagacagcagcaatggaaaattattgtgtt
agcatgttagctcatctttggggaattcctaagaatgaaaagatgtataaagactttatt
ggtacttcgactgtgggatcttcagaaggttgtatgcttggtggactagcgttattaatg
aactggaagcatcgtgcagaaaatattggattcgatattaaagatttgcatcatcaccag
ccaaacttggtgattatgtctggatatcaagtagtttgggaaaaattctgcacttactgg
aatgtggaattaagacaagttcctatcgaccaagaccacatgtctatggatatggatcgt
gtgatggattatgttgatgaaaacacaataggtattgttgggatccaaggaatcacctac
acgggtgctgtagacgatattcagcgtcttgacaagcttgttgatgaatataacaagagc
gctgtaatgccagttaagatccatgttgatggtgcttttggtgcaatgtttgccccattt
gtagatggatttaatccatgggattttagacttaagaatgttgtttcaattaatgtttca
ggtcacaaatatggaatggtataccctggcgttggttggattgtatggagacataatact
gaagaatacctaccaaaggaaatgcgtttcgaagtaccatatttaggatcaactgttgac
tcaattgccataaacttctcacatagtggtgcacatgtcgtgggtcaatactacaacttt
attcgttttgggttcaaaggttacaaagcaatcatggaaaatgttagaaatgtatccaaa
aagattacaaatgagcttgaaaatattggtatttttgaaattgtaaatgatggtagccaa
ttaccaattaattgttggaaactggcagacaatgctgatgttaactggaatttatatgat
ttagagtcagaactttctaagttcggttggcaagttccagcatatccactaccaaagaac
cgtcaggatacaaccattagtagaattgttgtaagaccatcaatgagtatgacaattact
aacgatttcattgatgacttgcacatggcaattcataatcttaatgaacaacatggtgga
gtcgtggaagatgaggcggaagccgaagttagcagtgctatgacaataaataagtag

DBGET integrated database retrieval system