KEGG   Cutibacterium acnes hdn-1: TIA1EST1_11175Help
Entry
TIA1EST1_11175    CDS       T03470                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pacn  Cutibacterium acnes hdn-1
Pathway
pacn00010  Glycolysis / Gluconeogenesis
pacn00030  Pentose phosphate pathway
pacn00051  Fructose and mannose metabolism
pacn00052  Galactose metabolism
pacn00680  Methane metabolism
pacn01100  Metabolic pathways
pacn01110  Biosynthesis of secondary metabolites
pacn01120  Microbial metabolism in diverse environments
pacn01130  Biosynthesis of antibiotics
pacn01200  Carbon metabolism
pacn01230  Biosynthesis of amino acids
pacn03018  RNA degradation
Module
pacn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA1EST1_11175
   00030 Pentose phosphate pathway
    TIA1EST1_11175
   00051 Fructose and mannose metabolism
    TIA1EST1_11175
   00052 Galactose metabolism
    TIA1EST1_11175
  09102 Energy metabolism
   00680 Methane metabolism
    TIA1EST1_11175
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    TIA1EST1_11175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pacn01009]
    TIA1EST1_11175
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pacn03019]
    TIA1EST1_11175
Enzymes [BR:pacn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIA1EST1_11175
Protein phosphatases and associated proteins [BR:pacn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TIA1EST1_11175
Messenger RNA biogenesis [BR:pacn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TIA1EST1_11175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AID36738
LinkDB All DBs
Position
2387299..2389563
Genome map
AA seq 754 aa AA seqDB search
MHVDDEMRLTPTLPDGHGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQG
MIDGGDGIRRFGWDDVGSILNRGGTVIGTFRCKGMRERPGRLKAVRNLLEHGIDRLVVIG
GDGSLTGLDVLRTEWTDLVAELVDTGQVSAEVAREHPALMIAGLVGSIDNDLVGSDMTIG
ADTALHRIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPED
GWEDRMCAELKRGRQAGRRDSIVVVAEGATDRSGNRISSEYVRQVLEDKLGEDARVTILG
HVQRGGRPSAYDRWASTWLGYHAVHEVLSTTPEAEGRVIGTGSNRIHRLPLVKAVADTKS
VPGLITEGRYNEAMPMRGRSFVEMDAIFTELSEPARTTSDTAGDADRKRVAIMHAGGPAP
GMNTAARAAVRLAISRGHTVVGIHNGFIGLATGDMSELAWSDVEGWAGEGGAELGTRREI
PSTRDLYAVSRALEDHHIDALLVIGGYSAYEGIYTMMTERDRYPAFRIPTVCIPASIDNN
LPGSELSIGTDTALNVIVEAMDKIKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERI
YTNEDGISLDDLANDVHWLRESFAHGRRLFLAVRNENASHNYTTDFIARLLEEESHGMYD
VRQVVLGHMQQGGSPSPFDRLLANRLGYRALNLIDDELAAHQDGSWFIGVNESGMRPCSM
DTMPSLIDAAHRRPREQWWLQLRTIARMVSDEVR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgttgatgacgagatgaggctcacccccactctccccgacggtcatggtctgcgc
attggcatcctgaccagcggtggcgacgctcagggcatgaacgctgctgtgcgggctgtg
gtgcgctctgcgctaagtgtgggagccgaggtctatgcgatatacgagggctaccaggga
atgatcgatggtggcgatggcatccgtaggttcgggtgggacgacgtcggctcgatcctc
aaccgtggcggcaccgtgatcggaaccttccgttgcaaggggatgcgcgaacgtccgggg
cgcctgaaggctgtcagaaatctcctcgaacacgggatcgatcgtctcgtcgtcatcggc
ggtgacggttcgctcaccggcctggatgtgctgcgcaccgaatggacagacctggtcgct
gaactcgtcgacaccggccaggtgagcgccgaggtagcccgggaacaccccgccctcatg
atcgccgggctcgtcggatccatcgacaatgacctcgtcggatccgatatgaccatcggt
gccgatactgctctgcaccgtattgtcgatgccatcgacgacctcgcctccaccgcggcc
agccaccagcgatccttcgtcgttgaggtgatgggccgccactgcggctatctcgccctt
atggcagcagttgccggcggagctgactatgttcttattccggaacggccgcccgaggac
ggttgggaggaccgcatgtgcgccgagctcaaacgtggccgtcaggcgggccgacgcgac
tcgatcgtcgtagtcgcggagggcgccaccgatcgttccgggaaccggatctcctcggag
tacgtccgccaggtgcttgaggacaaactcggtgaggacgcccgggttaccatcctgggc
cacgtccagcgcggcggacgaccgtcagcctatgaccgctgggcgtcgacctggttgggt
tatcatgcggttcacgaggtgctctcgaccactccagaggccgaggggcgcgttatcggc
actgggtccaaccgcatacatcgcctccccctggtcaaggccgtcgctgacacgaagtcg
gtgcccggtctcattacggagggccgttacaacgaggccatgccgatgaggggacgttcc
tttgtcgagatggacgcgatcttcaccgaactcagtgaaccagctcgtaccacttccgac
accgctggtgacgccgaccgcaagcgcgtcgcgatcatgcacgctggcggtccggccccg
ggcatgaatactgctgcccgtgctgcagtgcgactggcgatttcccgcggtcataccgtt
gtgggaatccataacgggttcatcggactagcgaccggggacatgtcggaattggcctgg
agcgacgtcgagggctgggccggggaaggcggcgctgagctgggtacccgccgcgagatc
cctagcactcgcgacctttatgctgtcagccgcgctctggaggatcatcacatcgacgcg
ttgctcgtcattggtggctactcggcctacgaaggtatctacaccatgatgactgagcgg
gaccggtacccggctttccgtattccgacggtgtgcattccggcttcgatcgacaacaac
ctccccggttcggaactgtccatcggcaccgacaccgctctcaacgtcattgtcgaggcg
atggacaagattaaagagtcgggtatcgcgtccagacgctgcttcgtcgtcgagacgatg
ggtcgtgactgcggatacctcgcgctgatgtcgggtatcgcagctggcgctgagcggatc
tataccaacgaggacggtatctccctggacgatctagccaacgacgtccattggttgcgg
gagtcattcgcccacggacgacgacttttccttgccgtgcgcaacgagaacgcatcgcac
aattacaccaccgacttcatcgcgcggctgctggaggaggaatcacacggcatgtatgac
gtacgccaggtggtactagggcatatgcagcaaggcggctcaccctcacctttcgaccgc
ttgctcgccaaccgactcgggtatcgcgctctcaatctcattgacgacgagttggcggcg
catcaggacggttcatggttcattggcgtcaacgagtcgggcatgcggccctgttcgatg
gacaccatgccctctctcattgacgccgctcatcgtcgtccccgcgaacagtggtggctg
caactgaggactattgccaggatggtctcggacgaggtgcggtaa

DBGET integrated database retrieval system